Recombinant Yersinia pestis bv. Antiqua sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

UgpA is a permease component of the Ugp ATP-binding cassette (ABC) transporter system, which facilitates G3P acquisition under phosphate-limiting conditions . In Y. pestis, this system is transcriptionally regulated by phosphate starvation, enabling survival in nutrient-depleted environments . The recombinant form is engineered for high-purity production in Escherichia coli systems, retaining functional properties for research applications .

Key Features:

  • UniProt ID: Q1CBH4

  • Gene Name: ugpA (YPO_0229 in Antiqua strain)

  • Protein Length: Partial sequence (1–295 amino acids)

  • Host System: E. coli

Domain Architecture:

UgpA is predicted to form transmembrane helices typical of ABC transporter permeases, facilitating G3P translocation across the inner membrane .

Functional Attributes:

  • Substrate Specificity: Binds G3P with high affinity, but not utilizable as a carbon source .

  • Role in Virulence: While not directly linked to plague pathogenesis, UgpA supports bacterial adaptation to host environments by scavenging phosphate .

Sequence Conservation:

  • Shares 98–100% identity across Y. pestis biovars (Antiqua, Mediaevalis, Orientalis) .

  • Diverges from Y. pseudotuberculosis homologs due to lineage-specific gene decay .

Expression Systems:

  • Host: E. coli (BL21 or similar strains) .

  • Tag: His-tag or untagged, depending on manufacturing protocols .

Purification Metrics:

ParameterSpecification
Purity>85% (SDS-PAGE)
Storage Stability6 months (liquid), 12 months (lyophilized)
Reconstitution0.1–1.0 mg/mL in Tris/PBS + 50% glycerol

Comparative Genomics:

Y. pestis Antiqua exhibits unique genomic deletions compared to other biovars, including pseudogenization of metabolic pathways . UgpA remains conserved, suggesting its critical role in phosphate acquisition .

Table 1: Genomic Deletions in Y. pestis Strains

StrainUnique Protein InactivationsShared Deletions with Antiqua
Antiqua4111 (with CO92)
Nepal516130

Biotechnological Uses:

  • Antigen Production: Utilized in ELISA kits for serological studies .

  • Structural Biology: Crystallization trials to resolve transmembrane topology .

Evolutionary Insights

Phylogenetic analyses confirm Y. pestis Antiqua as ancestral to modern biovars, diverging from Y. pseudotuberculosis 1,500–20,000 years ago . Despite extensive gene loss (e.g., tufB in Nepal516), UgpA remains intact, underscoring its metabolic essentiality .

Technical Limitations and Recommendations

  • Thermal Sensitivity: Requires storage at -80°C to prevent aggregation .

  • Activity Assays: Functional validation necessitates liposome reconstitution due to incompatibility with vesicle-based systems .

Future Directions

  • Pathogenicity Studies: Elucidate UgpA’s role in Y. pestis persistence in flea vectors.

  • Vaccine Development: Evaluate immunogenicity in animal models.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, storage temperature, and the protein's stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ugpA; YPA_0229; sn-glycerol-3-phosphate transport system permease protein UgpA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Antiqua)
Target Names
ugpA
Target Protein Sequence
MSPSRPGFSCSWLPYLLVLPQLAITAIFFLWPAGEALWYSVQTLDPFGLSSEFVGLSNFI QLFQDEYYLASFYTTLIFSALVAGIGLIVSLFLAAMVNYVLRGSRLYQTLLILPYAVAPA VAAVLWIFLFDPGLGLITHALAKLGYSWNHAQNSGQAMFLVVLASVWKQISYNFLFFLAA LQSIPKSLVEAAAIDGAGPVRRFFNLVLPLISPVSFFLLVVNLVYAFFDTFPVIDAATGG GPVQATTTLIYKIYREGFAGLDLSSSAAQSVILMLLVIGLTVIQFRFVERKVRYQ
Uniprot No.

Target Background

Function
This protein plays a role in the binding-protein-dependent transport system for sn-glycerol-3-phosphate. It is likely responsible for the translocation of the substrate across the membrane.
Database Links

KEGG: ypa:YPA_0229

Protein Families
Binding-protein-dependent transport system permease family, UgpAE subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UgpA protein in Yersinia pestis and what is its functional role?

UgpA functions as a permease protein within the sn-glycerol-3-phosphate transport system in Y. pestis. It forms part of a binding protein-dependent transport complex responsible for the uptake of sn-glycerol-3-phosphate across the bacterial membrane. The ugp-dependent transport system is specifically induced under conditions of phosphate starvation and is regulated as part of the pho regulon . Unlike some other transport systems, the ugp system does not operate in membrane vesicles and demonstrates high sensitivity toward osmotic shock, indicating its complex integration within the cell membrane architecture .

How is the UgpA permease structurally organized within the bacterial membrane?

UgpA is a transmembrane protein that forms part of the permease component of the ABC transporter complex. While the search results don't provide specific structural information for Y. pestis UgpA, research on homologous systems indicates that UgpA contains multiple transmembrane domains that anchor it within the cytoplasmic membrane. The protein likely forms a heterodimeric channel with UgpE (another permease component) that facilitates substrate translocation across the membrane. This channel works in conjunction with the periplasmic binding protein (UgpB) that captures substrate molecules and delivers them to the permease complex.

What experimental systems can be used to study UgpA expression?

For studying UgpA expression, researchers should consider the following methodological approaches:

  • Phosphate-limiting conditions: Cultivate Y. pestis in phosphate-limited media to naturally induce the pho regulon and upregulate ugpA expression .

  • Constitutive pho regulon mutants: Use bacterial strains with constitutive pho regulon expression to achieve consistent ugpA upregulation .

  • Gene reporter fusion systems: Construct ugpA-reporter gene fusions (such as ugpA-lacZ or ugpA-GFP) to monitor expression levels under different conditions.

  • RT-qPCR analysis: Quantify ugpA mRNA levels to measure transcriptional responses to various environmental conditions.

  • Western blotting: Develop antibodies against UgpA to detect and quantify protein expression levels, similar to antibody approaches used for other Y. pestis proteins .

How can recombinant UgpA protein be expressed and purified for in vitro studies?

Based on approaches used for similar Y. pestis proteins, the following methodology is recommended for recombinant UgpA:

Expression System Design:

  • Amplify the ugpA gene from Y. pestis genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Clone the amplified gene into an expression vector such as pET28a, which provides a His-tag for purification .

  • Transform the recombinant construct into an expression host such as E. coli BL21(DE3).

Protein Expression Protocol:

  • Grow transformed bacteria in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with IPTG (0.5-1 mM) and continue growth at a reduced temperature (16-28°C) for 4-16 hours.

  • Harvest cells by centrifugation and resuspend in lysis buffer containing protease inhibitors.

Purification Strategy:

  • Lyse cells using sonication or French press and clarify the lysate by centrifugation.

  • For membrane proteins like UgpA, include a detergent solubilization step using mild detergents like n-dodecyl-β-D-maltoside.

  • Purify the His-tagged protein using Ni-NTA affinity chromatography .

  • Further purify via size exclusion chromatography if needed.

  • Assess protein purity by SDS-PAGE and Western blotting.

What is the relationship between the UgpA permease and the periplasmic binding protein in the transport mechanism?

The relationship between UgpA and the periplasmic binding protein is essential for substrate transport:

  • The periplasmic binding protein captures sn-glycerol-3-phosphate in the periplasmic space with high affinity.

  • This binding protein is necessary but not sufficient for transport activity, as demonstrated through isolation of transport mutants lacking the binding protein .

  • After substrate binding, the periplasmic protein undergoes a conformational change and interacts with the permease complex containing UgpA.

  • This interaction triggers ATP hydrolysis by the associated ATPase component, providing energy for substrate translocation through the UgpA/UgpE channel.

  • Mutations affecting either component disrupt transport function, as shown by studies isolating transport-deficient mutants .

The experimental evidence clearly demonstrates that while the periplasmic binding protein is essential, the complete transport process requires functional interaction with the permease components including UgpA .

How does phosphate availability regulate UgpA expression and function?

The regulation of UgpA expression by phosphate availability occurs through the following mechanisms:

  • Pho regulon control: The ugp transport system is induced specifically under conditions of phosphate starvation and is regulated as part of the pho regulon .

  • Constitutive expression in pho mutants: Mutants that are constitutive for the pho regulon show constitutive expression of the ugp transport system, indicating direct regulatory control .

  • Carbon starvation effects: Research has shown that carbon starvation can also induce the ugp operon, suggesting complex regulatory networks beyond phosphate limitation alone .

  • Regulatory cascade: The PhoR-PhoB two-component regulatory system likely senses environmental phosphate levels and controls ugpA transcription through binding of phosphorylated PhoB to pho boxes in the ugp operon promoter region.

Table 1: Effects of Environmental Conditions on UgpA Expression

ConditionUgpA Expression LevelTransport ActivityRegulatory Mechanism
High phosphateLowMinimalRepression of pho regulon
Phosphate starvationHighMaximalActivation of pho regulon
Carbon starvationIncreasedModerateSecondary regulatory pathway
pho regulon constitutive mutantsConstitutiveHighMutation in regulatory elements

What are the techniques for measuring UgpA-mediated transport activity in Y. pestis?

Several sophisticated methodological approaches can be employed to measure UgpA-mediated transport:

  • Radioisotope uptake assays:

    • Use ¹⁴C-labeled sn-glycerol-3-phosphate to directly measure transport kinetics

    • Incubate bacteria with labeled substrate, filter cells, and measure accumulated radioactivity

    • Can be used to determine Km and Vmax values for transport

  • Nuclear magnetic resonance (NMR) analysis:

    • In vivo ³¹P NMR can be used to monitor internal Pi during the uptake of sn-glycerol-3-phosphate

    • Allows real-time monitoring of transport without disrupting cells

    • Provides insights into the kinetics of substrate movement and metabolism

  • Fluorescent substrate analogs:

    • Develop fluorescent analogs of sn-glycerol-3-phosphate

    • Monitor transport by measuring changes in fluorescence intensity

    • Can be combined with confocal microscopy for spatial analysis

  • Competitive inhibition studies:

    • Use toxic analogs like 3,4-dihydroxybutyl-1-phosphonate that compete for transport

    • Measure growth inhibition as an indirect measure of transport capacity

    • Can select for transport mutants by resistance to these analogs

  • Membrane vesicle studies:

    • Since the ugp system does not function in membrane vesicles, comparison with systems that do can provide insights into mechanism

    • Right-side-out vesicles vs. inside-out vesicles can clarify energy coupling mechanisms

How does UgpA contribute to Y. pestis pathogenesis and survival during infection?

The connection between UgpA and Y. pestis pathogenesis involves several aspects:

  • Phosphate acquisition during infection:

    • Host environments are often phosphate-limited, requiring efficient phosphate scavenging systems

    • The ugp system allows Y. pestis to utilize sn-glycerol-3-phosphate as a phosphate source during infection

    • This contributes to bacterial survival under stress conditions

  • Metabolic versatility:

    • Although sn-glycerol-3-phosphate transported via ugp cannot be used as the sole carbon source, it can be incorporated into phospholipids and other cellular components

    • This metabolic pathway flexibility enhances bacterial adaptation during host colonization

  • Relationship to virulence factors:

    • Y. pestis virulence involves multiple factors including F1 and LcrV antigens

    • The expression of transport systems like ugp may be coordinated with virulence factor expression under specific host conditions

    • Nutrient acquisition systems are essential for supporting the energy requirements of virulence factor production

  • Potential as a vaccine component:

    • While not directly mentioned in the search results for UgpA, other Y. pestis components have been used in vaccine development

    • Understanding UgpA structure and immunogenicity could inform future multi-component vaccine designs

What structural features of UgpA could be targeted for antimicrobial development?

Several structural and functional features of UgpA present potential targets for antimicrobial development:

  • Substrate binding pocket:

    • Identifying the specific amino acid residues involved in substrate recognition

    • Designing competitive inhibitors that bind with higher affinity than natural substrates

    • Modeling based on crystal structures of homologous transporters

  • Protein-protein interaction domains:

    • Targeting the interfaces between UgpA and other components of the transport system

    • Disrupting interactions with the periplasmic binding protein

    • Interfering with UgpA-UgpE heterodimerization

  • Channel gating mechanism:

    • Identifying residues involved in conformational changes during transport

    • Developing molecules that lock the channel in closed conformation

    • Exploiting differences between bacterial and host transport systems

  • Regulatory elements:

    • Targeting the phosphate-sensing mechanism that controls ugpA expression

    • Disrupting the pho regulon response to prevent upregulation during infection

    • Developing antisense molecules to block ugpA mRNA translation

  • Immunological targeting:

    • Identifying exposed epitopes of UgpA for antibody development

    • Potential for immunotherapy approaches using anti-UgpA antibodies

    • Consideration of UgpA as part of multi-component vaccine strategies

How can CRISPR-Cas9 genome editing be applied to study UgpA function in Y. pestis?

CRISPR-Cas9 genome editing provides powerful approaches to study UgpA function:

Precise Gene Knockout Protocol:

  • Design sgRNAs targeting the ugpA gene sequence with minimal off-target effects

  • Construct a CRISPR plasmid containing the sgRNA and Cas9 gene with appropriate promoters for Y. pestis

  • Include homology-directed repair templates to introduce marker genes or in-frame deletions

  • Transform Y. pestis with the CRISPR construct using electroporation

  • Select transformants and confirm knockout by PCR and sequencing

  • Evaluate phenotypic changes in growth, survival, and transport activity

Site-Directed Mutagenesis Applications:

  • Generate point mutations in functional domains to identify critical residues

  • Create chimeric proteins by swapping domains between UgpA and related transporters

  • Introduce reporter tags (e.g., fluorescent proteins) for localization studies

  • Create conditional expression systems by modifying promoter regions

Phenotypic Analysis Methods:

  • Growth kinetics in phosphate-limited media

  • Survival assays under various stress conditions

  • Transport activity measurements using radiolabeled substrates

  • In vivo infection models to assess virulence impacts

  • Transcriptomic analysis to identify compensatory responses

What are the methods for analyzing UgpA interactions with other components of the transport system?

Several methodological approaches can be used to study UgpA interactions:

  • Bacterial Two-Hybrid (B2H) System:

    • Clone ugpA and potential interaction partners into B2H vectors

    • Transform into reporter strains and measure interaction strength via reporter gene expression

    • Use truncated constructs to map interaction domains

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged UgpA in Y. pestis or heterologous hosts

    • Lyse cells under conditions that preserve protein-protein interactions

    • Immunoprecipitate UgpA complexes using anti-tag antibodies

    • Identify co-precipitated proteins by mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Purify recombinant UgpA and potential binding partners

    • Immobilize UgpA on SPR chip surface

    • Measure real-time binding kinetics of interacting proteins

    • Determine association and dissociation constants

  • Cross-linking Mass Spectrometry:

    • Treat intact cells or membrane preparations with chemical cross-linkers

    • Isolate cross-linked complexes containing UgpA

    • Analyze by mass spectrometry to identify interaction interfaces

    • Map cross-linked residues to structural models

  • Förster Resonance Energy Transfer (FRET):

    • Create fusion proteins of UgpA and interaction partners with fluorescent proteins

    • Express in living cells and measure FRET efficiency

    • Monitor dynamic interactions in response to substrate availability

How can comparative genomics be used to understand UgpA evolution across Yersinia species?

Comparative genomics approaches provide insights into UgpA evolution:

Methodological Workflow:

  • Collect ugpA sequences from multiple Yersinia species and strains

  • Include sequences from related Enterobacteriaceae as outgroups

  • Perform multiple sequence alignment using tools like MUSCLE or CLUSTALW

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate sequence conservation scores for each amino acid position

  • Map conservation data onto predicted structural models

Analytical Approaches:

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify positions under positive or purifying selection

    • Identify potential host adaptation signatures

  • Domain evolution analysis:

    • Compare conservation levels across different functional domains

    • Identify regions most susceptible to evolutionary changes

  • Horizontal gene transfer detection:

    • Analyze GC content, codon usage, and phylogenetic incongruence

    • Identify potential lateral acquisition events

Table 2: Conservation Analysis of Key UgpA Functional Domains

DomainConservation LevelSelection PressurePotential Function
Transmembrane Domain 1HighPurifyingMembrane anchoring
Transmembrane Domain 2ModerateNeutralChannel formation
Substrate Binding RegionVariableMixedSubstrate specificity
Binding Protein InteractionHighPurifyingEssential for transport
Cytoplasmic LoopLowPositiveSpecies-specific regulation

What are the recommended protocols for generating UgpA protein crystals for structural studies?

Crystallization of membrane proteins like UgpA requires specialized approaches:

Protein Preparation Protocol:

  • Express recombinant UgpA with affinity tags for purification

  • Extract and solubilize using mild detergents (DDM, LDAO, or C12E8)

  • Purify using affinity chromatography followed by size exclusion

  • Assess protein homogeneity using dynamic light scattering

  • Concentrate to 5-15 mg/ml while avoiding aggregation

Crystallization Strategies:

  • Detergent-based crystallization:

    • Prepare screens with varying precipitants, pH, and salt concentrations

    • Set up vapor diffusion trials (hanging or sitting drop)

    • Include additives that stabilize membrane proteins

  • Lipidic cubic phase (LCP) method:

    • Mix purified UgpA with monoolein or other lipids

    • Form cubic phase matrix and set up crystallization trials

    • Optimize with various precipitants and additives

  • Bicelle method:

    • Reconstitute UgpA into bicelles composed of DMPC/CHAPSO

    • Set up crystallization trials using bicelle-containing protein

    • Screen different bicelle compositions and protein:bicelle ratios

  • Antibody fragment co-crystallization:

    • Generate Fab fragments against UgpA to increase polar surface area

    • Form UgpA-Fab complexes and use for crystallization

    • Similar approaches have been successful with other Y. pestis proteins

Diffraction Data Collection:

  • Harvest crystals with appropriate cryoprotectants

  • Collect diffraction data at synchrotron radiation sources

  • Process data using XDS or similar software

  • Solve structure by molecular replacement or experimental phasing methods

What are the emerging technologies for studying UgpA dynamics during transport?

Several cutting-edge technologies are being applied to study transporter dynamics:

  • Cryo-electron microscopy (cryo-EM):

    • Capture UgpA in different conformational states during transport cycle

    • Reconstruct 3D structures at near-atomic resolution

    • Visualize substrate-induced conformational changes

  • Single-molecule FRET (smFRET):

    • Label specific residues in UgpA with fluorophore pairs

    • Monitor real-time conformational changes at single-molecule level

    • Correlate conformational dynamics with transport activity

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Probe solvent accessibility of different UgpA regions

    • Identify regions undergoing conformational changes during transport

    • Map dynamic behavior to functional states

  • Molecular dynamics simulations:

    • Develop atomistic models of UgpA in membrane environments

    • Simulate substrate binding and transport mechanisms

    • Predict effects of mutations on protein dynamics

  • In-cell NMR spectroscopy:

    • Isotopically label UgpA for NMR studies in living cells

    • Monitor structural changes under physiological conditions

    • Correlate with transport activity measurements

How might UgpA be leveraged for designing novel antimicrobial strategies against Y. pestis?

UgpA presents several opportunities for antimicrobial development:

  • Structure-based inhibitor design:

    • Use structural information to design molecules that block the transport channel

    • Develop compounds that compete with natural substrates

    • Create allosteric inhibitors that lock UgpA in inactive conformations

  • Genetic attenuation strategies:

    • Engineer UgpA mutations that create attenuated Y. pestis strains

    • Develop temperature-sensitive UgpA variants for live attenuated vaccines

    • Combine with other attenuating mutations for vaccine development

  • Immunological targeting:

    • Identify surface-exposed epitopes unique to Y. pestis UgpA

    • Develop antibodies that block transport function

    • Consider UgpA as part of multi-component vaccines similar to F1-LcrV approaches

  • Delivery system applications:

    • Exploit UgpA transport mechanism to deliver antimicrobial compounds

    • Design "Trojan horse" substrates that are transported but release toxic compounds intracellularly

    • Target dual-purpose molecules that inhibit both transport and other essential functions

  • Combination therapy approaches:

    • Identify synergistic effects between UgpA inhibitors and conventional antibiotics

    • Target multiple nutrient acquisition systems simultaneously

    • Develop treatments that block both phosphate and carbon acquisition pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.