Recombinant Yersinia pestis bv. Antiqua Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate your needs in the order remarks section. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery times.
Please note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; YpAngola_A1202; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
msrQ
Target Protein Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Uniprot No.

Target Background

Function
YedZ is part of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This system protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by the host defense mechanisms. MsrPQ is essential for maintaining envelope integrity under bleach stress, rescuing a wide range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural characterization of YedZ in Yersinia pestis and how does it differ from other bacterial species?

YedZ functions as a heme-binding subunit of the sulfoxide reductase system in Yersinia pestis. It belongs to the same family of enzymes as the TorZ/MtsZ system found in other bacterial species, which has been characterized as an S- and N-oxide reductase with specificity for S-sulfoxides . Unlike some other reductases that only reduce N-oxides, YedZ possesses critical tyrosine and tryptophan residues in its active site that enable it to reduce both S- and N-oxides . This is consistent with the broader pattern observed in combined S- and N-oxide reductases which contain both active site residues, while true N-oxide reductases like TorA lack the tyrosine residue .

What are the standard protocols for recombinant expression of Yersinia pestis YedZ?

The recombinant expression of Y. pestis proteins, including YedZ, typically employs vector-based systems with electroporation as the primary transformation method. Based on established protocols for Y. pestis proteins, the gene encoding YedZ can be inserted into a suitable expression vector similar to the technique used for GFP expression in Y. pestis . The transformation protocol typically involves preparing electrocompetent Y. pestis cells from natural strains, followed by electroporation of the vector containing the yedZ gene . After transformation, antibiotic selection (commonly using ampicillin) helps isolate transformants, which are then verified through molecular-genetic methods to confirm the presence and expression of the recombinant YedZ protein .

How does the recombinant expression affect YedZ functionality compared to native expression?

Recombinant expression can introduce several functional differences compared to native expression. Based on studies of similar systems, recombinant YedZ may exhibit altered catalytic efficiency depending on the expression system used. When expressing sulfoxide reductases recombinantly, proper incorporation of cofactors (particularly the heme group for YedZ) is critical for maintaining functionality . Expression levels must be optimized to prevent aggregation of the membrane-associated YedZ protein. Additionally, post-translational modifications present in native YedZ may be absent in recombinant systems, potentially affecting substrate specificity or catalytic rates. Researchers should verify the functional integrity of recombinant YedZ through activity assays comparing its ability to reduce model substrates such as methionine sulfoxide or biotin sulfoxide against purified native enzyme .

What methodological approaches are most effective for assessing YedZ's role in Y. pestis virulence and host-pathogen interactions?

To effectively assess YedZ's role in virulence, a multi-faceted approach combining genetic manipulation, in vitro assays, and in vivo models is recommended. First, create yedZ gene knockout mutants in Y. pestis using homologous recombination or CRISPR-Cas9 techniques. Compare these knockout strains with complemented strains (where yedZ is reintroduced) and wild-type strains across the following parameters:

  • Biofilm formation capacity using crystal violet staining and confocal microscopy

  • Survival rates within biofilms when exposed to oxidative stress

  • Interactions with host cells using fluorescently labeled bacteria (similar to GFP-expressing Y. pestis constructs)

  • In vivo virulence assessment in murine infection models

Research on similar reductases suggests that knockout strains may show significantly reduced biofilm formation and impaired host-cell interactions . For example, studies on TorZ/MtsZ demonstrated that strains lacking this enzyme were almost undetectable after 72 hours of infection, while approximately 3.6 × 10³ CFU/mL of wild-type strains remained viable under identical conditions .

How can the substrate specificity of YedZ be experimentally determined and what implications does this have for understanding Y. pestis metabolism?

The substrate specificity of YedZ can be determined through a systematic enzymatic analysis approach:

Methodological Protocol:

  • Express and purify recombinant YedZ using affinity chromatography

  • Conduct enzyme activity assays with various potential substrates including:

    • Methionine sulfoxide (MetSO)

    • Biotin sulfoxide (BSO)

    • Dimethyl sulfoxide (DMSO)

    • Trimethylamine N-oxide (TMAO)

  • Determine kinetic parameters (Km, Vmax, kcat) for each substrate

  • Perform site-directed mutagenesis of key active site residues (particularly the tyrosine and tryptophan residues) to assess their contribution to substrate preference

Example Kinetic Parameters Table:

SubstrateKm (μM)Vmax (μmol/min/mg)kcat (s⁻¹)kcat/Km (M⁻¹s⁻¹)
MetSO45 ± 512.4 ± 1.18.5 ± 0.71.9 × 10⁵
BSO120 ± 128.3 ± 0.95.7 ± 0.54.8 × 10⁴
DMSO380 ± 353.2 ± 0.42.2 ± 0.35.8 × 10³
TMAO450 ± 402.8 ± 0.31.9 ± 0.24.2 × 10³

Based on similar reductases, MetSO is likely to be the preferred substrate as indicated by the higher kcat/Km value . Understanding YedZ's substrate preference provides insights into Y. pestis metabolism, particularly its adaptation to oxidative stress environments encountered during host infection. The inability to reduce protein-bound sulfoxides (as seen with similar enzymes unable to repair oxidized Calmodulin) suggests YedZ may function primarily in cellular metabolism rather than protein repair mechanisms .

What strategies can overcome the challenges in crystallizing membrane-associated YedZ for structural studies?

Crystallizing membrane proteins like YedZ presents significant challenges due to their hydrophobic nature. The following methodological approach addresses these challenges:

  • Protein Engineering Strategies:

    • Create truncated constructs removing highly flexible regions

    • Design fusion proteins with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Introduce surface entropy reduction mutations to promote crystal contacts

  • Detergent Screening Protocol:

    • Systematically test a panel of detergents (n-Dodecyl β-D-maltoside, n-Octyl-β-D-glucoside, LDAO, etc.)

    • Assess protein stability in each detergent using thermal shift assays

    • Evaluate monodispersity through size exclusion chromatography

  • Crystallization Approaches:

    • Lipidic cubic phase (LCP) crystallization for membrane proteins

    • Bicelle crystallization method

    • Vapor diffusion with specific additives (e.g., heme cofactors, substrate analogs)

  • Alternative Structural Methods:

    • Cryo-electron microscopy for membrane proteins resistant to crystallization

    • NMR spectroscopy for dynamic regions

Expected Outcomes Table:

MethodResolution RangeAdvantagesLimitations
X-ray crystallography with LCP1.5-3.0 ÅHigh resolution, captures active site detailsRequires well-diffracting crystals
Cryo-EM2.5-4.0 ÅNo crystallization needed, captures different conformationsLower resolution for smaller proteins
NMRSite-specific informationProvides dynamic informationLimited to smaller constructs

Success has been achieved with similar heme-binding proteins by including the heme cofactor during purification and crystallization steps, as this enhances protein stability and provides a structured region that can facilitate crystal contacts.

How can researchers design experiments to investigate the role of YedZ in Y. pestis survival during oxidative stress conditions?

A comprehensive experimental design should include:

  • Growth and Survival Assays:

    • Compare wild-type, ΔyedZ knockout, and complemented strains

    • Expose cultures to increasing concentrations of H₂O₂, superoxide, or nitric oxide donors

    • Measure survival rates at different timepoints (0, 2, 4, 8, 24 hours)

    • Include relevant controls (e.g., strains with known oxidative stress response genes knocked out)

  • Gene Expression Analysis:

    • Perform RNA-Seq or qRT-PCR on wild-type vs. ΔyedZ strains under oxidative stress

    • Monitor expression changes in related oxidative stress response genes

    • Use time-course experiments to capture dynamic responses

  • Biochemical Characterization:

    • Measure intracellular redox state using redox-sensitive fluorescent proteins

    • Quantify levels of oxidized biomolecules (proteins, lipids, DNA) in wild-type vs. ΔyedZ strains

    • Monitor the reduction rate of key sulfoxides in cell extracts

Based on studies with similar bacterial reductases, researchers should pay particular attention to the bacterium's ability to survive within macrophages, as these cells generate high levels of reactive oxygen species . The Experimental Design Assistant (EDA) can be valuable for planning these experiments, helping researchers identify variables that could confound outcomes and providing advice on randomization and statistical analysis .

What are the optimal controls and experimental variables when assessing the impact of YedZ mutations on Y. pestis virulence?

When designing experiments to assess how YedZ mutations impact Y. pestis virulence, researchers should implement the following controls and variables:

Essential Controls:

  • Wild-type Y. pestis strain (positive control for virulence)

  • Complete yedZ deletion mutant (negative control)

  • Complemented strain (yedZ gene reintroduced on plasmid)

  • Site-directed mutants targeting only the active site residues

  • Non-virulent Y. pestis strain (laboratory attenuated)

Critical Experimental Variables:

  • Mutation Types:

    • Catalytic residue mutations (active site tyrosine and tryptophan)

    • Heme-binding site mutations

    • Membrane anchoring domain mutations

    • Regulatory region mutations

  • Infection Models:

    • Cell culture systems (macrophages, epithelial cells)

    • Insect models (fleas as natural vectors)

    • Rodent models (mice with varying genetic backgrounds)

  • Measurement Parameters:

    • Bacterial load in tissues

    • Survival rates

    • Cytokine/chemokine profiles

    • Histopathological changes

The EDA tool can help researchers develop a rigorous experimental design by providing an explicit diagram of the experimental plan and generating a randomization sequence that accounts for blocking factors . This approach ensures that the experiments avoid common pitfalls in design and analysis, ultimately improving the reproducibility of results .

How should researchers approach the creation of a fluorescently tagged YedZ construct while preserving protein function?

Creating a fluorescently tagged YedZ construct requires careful consideration to maintain protein function. The following methodological approach is recommended:

  • Construct Design Strategy:

    • Perform in silico structural analysis to identify optimal fusion sites

    • Create multiple constructs with the fluorescent tag at:

      • C-terminus (less likely to disrupt function if C-terminus is cytoplasmic)

      • N-terminus (if N-terminus is not involved in membrane insertion)

      • Internal loops (if identified as flexible and surface-exposed)

    • Consider using small fluorescent tags (e.g., FlAsH tag) if protein size is a concern

    • Include flexible linkers (GGGGS)n between YedZ and the fluorescent protein

  • Validation Protocol:

    • Confirm proper membrane localization using membrane fractionation

    • Verify fluorescent signal colocalizes with membrane markers

    • Conduct enzymatic activity assays to ensure the tagged protein retains function

    • Compare growth characteristics and stress responses to untagged YedZ

Drawing on experience with GFP-tagged Y. pestis constructs, electroporation has proven to be an effective method for introducing the recombinant constructs . After transformation, it's essential to verify that the fluorescently tagged strain maintains the same cultural-morphological and biochemical properties as the original strain .

How can researchers address conflicting data between in vitro and in vivo studies of YedZ function?

When faced with discrepancies between in vitro and in vivo results regarding YedZ function, researchers should implement this systematic approach:

  • Methodological Reconciliation:

    • Examine differences in experimental conditions (pH, temperature, ionic strength)

    • Assess whether the protein preparation maintains native conformation and cofactors

    • Verify that in vitro substrates reflect physiological concentrations and compositions

  • Integrative Analysis Framework:

    • Perform correlation analyses between in vitro activity and in vivo phenotypes

    • Use mathematical modeling to account for differences in substrate availability

    • Consider cellular compartmentalization effects absent in purified systems

  • Complementary Approaches:

    • Develop cell-based assays that bridge the gap between purified enzymes and animal models

    • Use chemical biology approaches (e.g., activity-based protein profiling) to monitor enzyme activity in living cells

    • Implement proteomics to identify interaction partners present in vivo but absent in vitro

Similar challenges have been documented with other bacterial reductases, where enzymatic preferences observed in vitro (such as the preference for methionine sulfoxide) needed to be validated in cellular contexts to confirm physiological relevance .

What statistical approaches are most appropriate for analyzing YedZ knockout phenotypes in virulence studies?

For robust statistical analysis of YedZ knockout phenotypes in virulence studies, researchers should consider:

  • Experimental Design Considerations:

    • Use power calculations to determine appropriate sample sizes

    • Implement randomization to minimize bias

    • Ensure proper blinding during data collection and analysis

    • Include relevant blocking factors (e.g., animal age, weight, sex)

  • Statistical Methods Based on Data Type:

    • For survival data: Kaplan-Meier survival analysis with log-rank tests

    • For bacterial burden: Mixed-effects models to account for repeated measures

    • For multiple cytokine measurements: Multivariate analysis with appropriate corrections for multiple comparisons

    • For binary outcomes: Logistic regression with relevant covariates

  • Advanced Analysis Approaches:

    • Principal Component Analysis for dealing with multiple correlated phenotypes

    • Bayesian hierarchical modeling for integrating data across different experimental scales

    • Machine learning algorithms for identifying patterns in complex phenotypic data

The Experimental Design Assistant (EDA) can be particularly helpful in identifying the appropriate statistical methods based on the experimental design . It helps researchers avoid common pitfalls in statistical analysis by providing tailored critique and suggestions for optimization .

How can metabolomic approaches be integrated with genetic studies to understand the physiological role of YedZ in Y. pestis?

Integrating metabolomics with genetic studies offers powerful insights into YedZ function:

Methodological Integration Framework:

  • Experimental Design:

    • Compare metabolite profiles of wild-type, ΔyedZ, and complemented strains

    • Include strains with point mutations in key residues

    • Sample at multiple timepoints during growth and under various stress conditions

    • Analyze both intracellular metabolites and secreted compounds

  • Analytical Approaches:

    • Targeted LC-MS/MS for known sulfoxide-containing metabolites

    • Untargeted metabolomics to discover novel YedZ substrates

    • Stable isotope labeling to track sulfoxide metabolism

    • Flux analysis to determine the impact of YedZ on metabolic pathways

  • Data Integration Strategy:

    • Correlate metabolite changes with transcriptomic alterations

    • Map identified metabolites to biochemical pathways

    • Use network analysis to identify metabolite clusters affected by YedZ

    • Validate key findings with isotope-labeled substrate feeding experiments

Example Integration Results Table:

MetaboliteFold Change in ΔyedZAssociated PathwayCorrelated Gene Expression Changes
Free MetSO+3.8Methionine metabolismUpregulation of alternative reductases
Biotin sulfoxide+2.4Biotin metabolismDownregulation of biotin-dependent enzymes
DMSO+1.2Anaerobic respirationMinimal changes in respiratory genes
TMAO+0.9Anaerobic respirationNo significant changes

Based on studies of similar reductases, MetSO is likely to accumulate significantly in ΔyedZ strains, as it appears to be the preferred substrate for this class of enzymes . This integrated approach would help determine whether YedZ functions primarily in sulfoxide-based energy generation or in maintaining redox homeostasis within the bacterial cell.

What are the key challenges in purifying active YedZ protein and how can they be overcome?

Purifying active YedZ presents several challenges due to its membrane localization and heme cofactor requirement. The following methodological approach addresses these issues:

  • Expression System Optimization:

    • Test multiple expression systems (E. coli, Y. pestis, cell-free)

    • Use inducible promoters with tunable expression levels

    • Supplement growth medium with δ-aminolevulinic acid to enhance heme biosynthesis

    • Consider low-temperature induction to improve proper folding

  • Extraction and Solubilization Protocol:

    • Screen detergents systematically (starting with mild detergents like DDM, LMNG)

    • Optimize detergent-to-protein ratios to prevent aggregation

    • Include stabilizing agents (glycerol, specific lipids) in buffers

    • Test membrane scaffold proteins or nanodiscs for native-like environment

  • Purification Strategy:

    • Implement two-step affinity chromatography (e.g., IMAC followed by heme-affinity)

    • Use size exclusion chromatography to confirm monodispersity

    • Monitor heme content spectroscopically throughout purification

    • Verify activity at each purification step

  • Activity Preservation Measures:

    • Maintain reducing conditions to prevent oxidation of critical thiols

    • Include substrate analogs or inhibitors to stabilize active conformation

    • Optimize buffer composition based on thermal stability assays

    • Consider rapid purification protocols to minimize time ex vivo

Similar challenges have been reported for other bacterial reductases, where maintaining the proper cofactor association during purification was critical for preserving enzymatic activity .

How can researchers distinguish between direct and indirect effects of YedZ mutation in complex host-pathogen interaction studies?

Distinguishing direct from indirect effects requires a multi-faceted approach:

  • Genetic Complementation Strategy:

    • Create a complementation library with:

      • Wild-type YedZ

      • Catalytically inactive YedZ (active site mutations)

      • Structural variants (affecting localization but not activity)

    • Use inducible expression systems to control timing and level of complementation

    • Implement domain swapping with homologous proteins to identify critical regions

  • Temporal Analysis Framework:

    • Perform time-course experiments to establish the sequence of events

    • Use pulse-chase approaches to determine primary vs. secondary effects

    • Implement inducible gene expression/repression systems for temporal control

  • Biochemical Validation Approaches:

    • Conduct in vitro reconstitution experiments with purified components

    • Use substrate analogs and specific inhibitors to confirm direct targets

    • Implement chemical genetics approaches with engineered sensitivity

  • Systems-Level Analysis:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Construct network models to identify direct YedZ targets

    • Validate predictions using targeted interventions

Similar strategies have been employed when studying other bacterial enzymes involved in host-pathogen interactions, where careful genetic complementation experiments helped distinguish between direct enzymatic effects and indirect consequences of protein absence .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.