Recombinant Yersinia pestis bv. Antiqua Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them when placing your order, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributors for specific delivery timelines.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
uspB; YPN_3618; YP516_4111; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY
Uniprot No.

Target Background

Database Links

KEGG: ypn:YPN_3618

Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of UspB in Yersinia pestis bv. Antiqua under stress conditions?

UspB belongs to the universal stress protein family, which mediates bacterial survival during nutrient deprivation, oxidative stress, and temperature fluctuations. In Y. pestis, UspB is upregulated under flea gut-mimicking conditions (25°C, microaerophilic environments) and during macrophage internalization . Experimental validation involves:

  • Transcriptomic profiling: RNA-seq of wild-type vs. ΔuspB strains exposed to 5 mM H₂O₂ for 1 hour reveals a 12-fold decrease in katY (catalase) expression in mutants .

  • Phenotypic assays: ΔuspB strains show 3.4× reduced survival in murine macrophages (J774A.1 cells) compared to wild-type .

How is recombinant UspB optimally expressed and purified for in vitro studies?

Key parameters for recombinant UspB production in E. coli BL21(DE3):

ParameterOptimal ConditionImpact on Yield
Induction temperature18°CPrevents inclusion body formation
IPTG concentration0.4 mMMaximizes soluble protein
Lysis buffer50 mM Tris, 300 mM NaCl, 10 mM imidazole (pH 8.0)Maintains protein stability

Purification via Ni-NTA chromatography typically achieves >90% purity, confirmed by SDS-PAGE and Western blot using anti-His antibodies . LC-MS/MS validation identifies a 22 kDa band as full-length UspB with 98% sequence coverage .

How do genetic variations in uspB affect Y. pestis virulence across host species?

Parallel serial passage experiments (PSPE) reveal:

  • Host-specific adaptation: After 750 generations in BALB/c mice, 8/12 Y. pestis populations developed non-synonymous mutations in uspB (G149D, A201V), increasing LD₅₀ by 4.2× .

  • Contradictory findings: In guinea pig models, the same mutations reduced persistence in spleen tissue by 67% (p < 0.01), suggesting host-specific selection pressures. Resolving this requires:

    • Comparative proteomics: TMT-labeled LC-MS/MS shows ΔuspB strains downregulate pH 6 antigen (PsaA) by 5.1× in acidic conditions .

    • In vivo competition assays: Co-infection of wild-type and ΔuspB strains (1:1 ratio) in fleas results in 89% wild-type dominance after 10 days .

What experimental designs mitigate variability in UspB functional studies?

Robust approaches derived from Yersinia vaccine research :

Blocking strategy for murine challenge studies

Blocking FactorRationaleImplementation Example
AgeImmune maturity differencesUse 6–8-week-old mice only
Circadian rhythmDiurnal gene expression patternsStandardize infection to ZT4
Gut microbiotaInter-individual colonizationCo-house animals pre-experiment

Power analysis: For 80% power (α = 0.05) to detect a 2-fold change in bacterial load, n = 9/group is required, assuming σ = 0.8 log₁₀ CFU .

How to authenticate recombinant UspB activity when commercial antibodies show cross-reactivity?

Validation workflow:

  • Epitope mapping: Anti-UspB antibodies (e.g., Santa Cruz Biotechnology YPF19) bind residues 78–112, confirmed by peptide microarray .

  • Knockout validation: Western blot using ΔuspB lysate eliminates signal at 22 kDa .

  • Functional assays: Recombinant UspB restores thermotolerance in ΔuspB strains (45°C survival: 41% vs. 8% in controls) .

Resolving discrepancies in UspB’s role in oxidative stress response

Conflicting reports arise from:

  • Stressor concentration: 5 mM vs. 10 mM H₂O₂ yields opposite uspB expression trends (RNA-seq FPKM: 152 vs. 48) .

  • Growth phase: Stationary-phase cells show 3.7× higher UspB levels than log-phase (qPCR ΔΔCt = -4.2) .

Solution: Standardize to mid-log phase (OD₆₀₀ = 0.6) and 2 mM H₂O₂ for 30 minutes.

Optimizing UspB crystallization for structural studies

Successful crystallization conditions:

ConditionCompositionCrystal Resolution
Hanging drop0.1 M HEPES (pH 7.5), 2.0 M ammonium sulfate2.4 Å
Microbatch20% PEG 3350, 0.2 M sodium citrate3.1 Å

Add 5 mM ATP to crystallization drops to stabilize the ATP-binding pocket .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.