Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPN_2369 (YPN_2369)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yersinia pestis bv. Antiqua UPF0059 Membrane Protein

Yersinia pestis has undergone extensive study at the molecular level due to its historical and ongoing significance as a pathogen. The bacterium exists in several strains, with the Antiqua biovar representing one of the three classical lineages. Strain Nepal516 specifically belongs to this biovar and has been fully sequenced, revealing a genome of approximately 4.5 Mb that encodes around 3,956 open reading frames . The YPN_2369 gene within this genome encodes the UPF0059 membrane protein, which belongs to a family of proteins whose functions remain largely uncharacterized.

Recombinant technology enables the production of this protein through genetic engineering, where the YPN_2369 gene is isolated, cloned, and expressed in a host organism different from its original source. This process facilitates the production of sufficient quantities for research and commercial applications while maintaining the protein's structural and functional properties.

Expression and Purification Methods

The recombinant YPN_2369 protein can be produced using various expression systems, each offering different advantages depending on the research requirements. The choice of expression system impacts yield, production time, and the preservation of structural and functional characteristics.

Bacterial and Yeast Expression Systems

Escherichia coli and yeast expression systems are frequently utilized for producing recombinant YPN_2369 due to their ability to generate higher yields with shorter turnaround times . These systems are particularly advantageous when large quantities of protein are needed quickly and when complex post-translational modifications are not critical for the intended application. The simplified cellular machinery of these organisms allows for efficient production of the target protein.

Table 2: Comparison of Expression Systems for Recombinant YPN_2369

Expression SystemAdvantagesDisadvantagesRecommended Applications
E. coliHigh yields, Short turnaround timeLimited post-translational modificationsStructural studies, Antibody production
YeastGood yields, Some post-translational modificationsMore complex than bacterial systemsFunctional studies requiring basic modifications
Insect cells (Baculovirus)More complex post-translational modificationsLower yields, Longer production timeStudies requiring properly folded protein
Mammalian cellsMost complete post-translational modificationsLowest yields, Longest production timeStudies requiring native protein activity

Genomic Context in Yersinia pestis bv. Antiqua

Understanding the genomic context of YPN_2369 provides valuable insights into its evolutionary history and potential functional relationships. The gene is part of the genome of Yersinia pestis bv. Antiqua strain Nepal516, which has undergone detailed sequencing and analysis .

Comparative genomic analyses between different Yersinia pestis strains, including Antiqua and Nepal516, have revealed strain-specific rearrangements, insertions, deletions, and single nucleotide polymorphisms . These variations contribute to the unique characteristics of each strain and potentially to differences in pathogenicity and host interactions.

Table 4: Genomic Features of Yersinia pestis bv. Antiqua Strain Nepal516

FeatureDescription
Genome Size~4.5 Mb
Number of Open Reading Frames~3,956
BiovarAntiqua
Gene IdentifierYPN_2369 (Ordered Locus Name)
Alternative NameYP516_2667 (ORF Name)
Strain ClassificationClassical biovar, separate phylogenetic lineage

Comparative Analysis with Other Membrane Proteins

While distinct from other well-characterized membrane proteins, comparative analysis of YPN_2369 with other membrane proteins can provide valuable context. For instance, unlike the transmembrane (TM) protein of J paramyxovirus, which has been shown to play a role in cell-to-cell fusion , the specific function of YPN_2369 remains to be fully characterized.

Type II integral membrane proteins, like the TM protein of J paramyxovirus, are oriented with their N-terminus in the cytoplasm and C-terminus extracellularly . While structural predictions suggest potential similarities, direct experimental evidence comparing YPN_2369's membrane orientation and function to other membrane proteins is limited in the current literature.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; YPN_2369; YP516_2667; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
mntP
Target Protein Sequence
MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA
Uniprot No.

Target Background

Function
This protein likely functions as a manganese efflux pump.
Database Links

KEGG: ypn:YPN_2369

Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPN_2369?

Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPN_2369 is a full-length protein (189 amino acids) that can be expressed with tags such as His-tag for research purposes . The protein is derived from Yersinia pestis biovar Antiqua, the causative agent of plague, and belongs to the UPF0059 family of membrane proteins whose specific function remains under investigation. When produced recombinantly, the protein is typically expressed in heterologous systems such as E. coli, which provides a convenient platform for generating sufficient quantities for research applications . The recombinant version allows researchers to study the protein's structure, function, and potential role in Yersinia pestis pathogenicity without handling the highly virulent native organism. Understanding this protein may contribute to broader knowledge about bacterial membrane proteins and potentially inform therapeutic approaches against plague.

What expression systems are recommended for YPN_2369 protein production?

For optimal expression of Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPN_2369, E. coli and yeast expression systems typically offer the best combination of high yields and relatively short production timelines . E. coli systems, particularly using BL21(DE3) or similar strains, are often the first choice due to their rapid growth, established protocols, and cost-effectiveness for membrane protein expression. When higher eukaryotic post-translational modifications are required for proper protein folding or activity, insect cell expression using baculovirus vectors or mammalian cell expression systems can be employed, though these typically result in lower yields and longer production times . The choice of expression system should be guided by the specific research requirements, balancing considerations of protein authenticity, yield, time constraints, and available resources. For structural studies requiring large protein quantities, E. coli remains the preferred system, while functional studies might benefit from expression in systems that more closely mimic the native environment.

How can I assess the purity and integrity of recombinant YPN_2369?

Assessing the purity and integrity of recombinant YPN_2369 requires employing multiple complementary analytical techniques to ensure comprehensive characterization. SDS-PAGE analysis represents the primary method for evaluating protein purity, with a single band at approximately the expected molecular weight (~21 kDa plus tag size) indicating a homogeneous preparation. Western blotting using either anti-His antibodies (for His-tagged protein) or specific antibodies against YPN_2369 can confirm the identity of the protein and detect potential degradation products. Size-exclusion chromatography provides further assessment of sample homogeneity and can identify protein aggregates or oligomeric states. Mass spectrometry techniques, particularly MALDI-TOF or ESI-MS, offer precise molecular weight determination and can verify the complete amino acid sequence through peptide mass fingerprinting after proteolytic digestion. For membrane proteins like YPN_2369, additional techniques such as circular dichroism spectroscopy can evaluate secondary structure integrity, which is particularly important when studying proteins in different detergent environments or reconstituted systems.

What buffer conditions are optimal for YPN_2369 stability?

The stability of recombinant YPN_2369 membrane protein is highly dependent on carefully optimized buffer conditions that maintain protein integrity while preventing aggregation. Most membrane proteins, including YPN_2369, require the presence of suitable detergents or lipids to remain properly folded and stable, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) frequently proving effective. Buffer pH typically ranges from 7.0-8.0 to mimic physiological conditions, with phosphate or Tris-based buffers (20-50 mM) commonly employed, supplemented with 100-150 mM NaCl to maintain ionic strength and reduce non-specific interactions. The addition of glycerol (5-10%) often enhances protein stability by preventing aggregation during freeze-thaw cycles, while reducing agents like DTT or β-mercaptoethanol (1-5 mM) may be necessary if the protein contains critical cysteine residues. Stability trials examining multiple buffer compositions, pH values, salt concentrations, and additives should be conducted through approaches like thermal shift assays or time-course activity measurements to identify optimal conditions for both short-term handling and long-term storage of YPN_2369.

How can I design experiments to characterize the function of YPN_2369?

Designing experiments to characterize the function of YPN_2369 requires a multi-faceted approach that integrates computational predictions with empirical methodologies. Begin with bioinformatic analyses using tools like BLAST, Pfam, and structural prediction software to identify conserved domains, potential binding partners, or functional motifs that might suggest biological roles . Construct a series of YPN_2369 mutants targeting predicted functional residues, using site-directed mutagenesis to systematically alter conserved amino acids, followed by expression and purification using established protocols for the wild-type protein . Experimental characterization should proceed through a hierarchical approach, starting with binding assays to identify interaction partners, including potential ligands, proteins, or nucleic acids, using techniques such as surface plasmon resonance, isothermal titration calorimetry, or pull-down assays with cellular extracts. Functional assays might include reconstitution into artificial membrane systems to test for transporter activity, channel formation, or enzymatic functions, with precise measurements of ion flux, substrate transport, or catalytic conversion rates. Complementary in vivo approaches, such as gene knockout/complementation studies in model systems, can validate findings from in vitro experiments, while crystallography or cryo-EM structural studies would provide mechanistic insights at the molecular level.

What experimental design approaches are most suitable for studying membrane protein interactions of YPN_2369?

When investigating membrane protein interactions of YPN_2369, implementing a robust experimental design framework is essential to generate reliable and reproducible results . A quantitative experimental approach should first establish baseline interaction parameters using controlled variables and minimizing experimental artifacts by including appropriate negative controls and validation methods . Co-immunoprecipitation experiments using tagged YPN_2369 can identify potential protein partners from cellular lysates, while proximity-labeling approaches such as BioID or APEX2 can capture transient or weak interactions in the native membrane environment. For detailed kinetic and thermodynamic characterization, surface plasmon resonance or microscale thermophoresis provides quantitative binding parameters, requiring careful experimental design with multiple protein concentrations, replicate measurements, and statistical analysis . Implementing the split reporter assays (such as split-GFP, BRET, or FRET) enables monitoring of interactions in real-time and in living cells, providing spatial and temporal dimensions to the interaction data. Cross-validation of interactions using multiple independent methods strengthens confidence in results, while carefully designed controls must account for potential effects of fusion tags, detergents, or expression systems on protein behavior . The experimental design should also consider the membrane environment's influence, potentially employing different membrane mimetics (nanodiscs, liposomes, or native membrane extracts) to assess context-dependent interactions.

How can recombination analysis techniques be applied to study YPN_2369 evolution?

Recombination analysis of YPN_2369 requires sophisticated computational and experimental approaches to understand its evolutionary history and functional adaptation. Researchers should begin by assembling a comprehensive dataset of YPN_2369 homologs from diverse Yersinia strains and related species, ensuring sequence authenticity through multiple alignment and quality control steps . Computational detection of recombination events should employ a suite of complementary methods, similar to the approach used in coronavirus studies, including RDP, BOOTSCAN, MAXCHI, CHIMAERA, 3SEQ, GENECONV, and SISCAN to identify potential breakpoints and recombination signals . Establishing confidence levels for detected recombination events follows a hierarchical framework: events identified by only one or two methods receive "low" confidence designation, those detected by at least three methods earn "moderate" confidence, and those confirmed by multiple methods with no alternative explanations achieve "high" confidence status . Temporal analysis of sequence evolution using Bayesian time-scaled phylogenetic methods can reveal how recombination events have shaped the protein's evolutionary trajectory, requiring careful removal of recombinant sequences to avoid skewing temporal structure estimates, as demonstrated in coronavirus studies where recombination substantially altered estimates of time to most recent common ancestor (TMRCA) . Experimental validation of computationally predicted recombination events may involve ancestral sequence reconstruction and functional characterization of predicted ancestral and recombinant forms to assess the phenotypic consequences of recombination.

What are the considerations for designing crystallization experiments for YPN_2369?

Designing crystallization experiments for YPN_2369 membrane protein requires meticulous attention to protein sample quality, crystallization conditions, and data collection strategies. The initial critical step involves producing highly pure (>95%), homogeneous, and conformationally stable protein, typically requiring extensive optimization of expression systems and purification protocols . Detergent selection represents a crucial variable, with systematic screening of different detergent types (maltoside, glucoside, or neopentyl glycol-based) and concentrations necessary to maintain protein stability while allowing protein-protein contacts essential for crystal formation. Lipidic cubic phase (LCP) or bicelle crystallization methods often yield better results for membrane proteins compared to traditional vapor diffusion approaches, requiring specialized setup and optimization protocols. Initial crystallization screens should be comprehensive, testing hundreds of conditions with varying precipitants, buffers, salts, and additives at different temperatures, with promising conditions subjected to fine grid screening around initial hits. Advanced approaches to improve diffraction quality include LCP additive screening, controlled dehydration, or co-crystallization with antibody fragments, nanobodies, or designed binding proteins that can stabilize flexible regions. Data collection considerations include cryoprotection optimization, radiation damage mitigation strategies, and potentially the use of micro-focus beamlines or serial crystallography approaches for small or poorly diffracting crystals, ensuring sufficient completeness and redundancy for structural determination.

What purification strategies yield the highest purity of recombinant YPN_2369?

Achieving high-purity recombinant YPN_2369 requires implementing a strategic multi-step purification approach optimized for membrane proteins. The initial solubilization step is critical, typically employing mild detergents like n-dodecyl-β-D-maltoside (DDM) or n-octyl-β-D-glucoside (OG) at concentrations slightly above their critical micelle concentration (CMC) to efficiently extract the protein from membranes without denaturation . For His-tagged YPN_2369, immobilized metal affinity chromatography (IMAC) provides an effective first purification step, with optimized imidazole gradients to reduce non-specific binding while maximizing target protein recovery . Size exclusion chromatography (SEC) as a polishing step separates monomeric protein from aggregates and remaining contaminants, simultaneously providing valuable information about the protein's oligomeric state and homogeneity. Additional purification steps may include ion exchange chromatography if the protein's isoelectric point offers sufficient charge separation from contaminants, or affinity chromatography with specific ligands if available. Throughout the purification process, all buffers should contain appropriate detergent concentrations (typically at 2-3× CMC) and potential stabilizers like glycerol to maintain protein integrity. The table below summarizes typical purification yields and purity assessments at each stage:

Purification StageTypical Yield (mg/L culture)Purity Assessment MethodTypical Purity (%)
Crude Membrane Fraction50-100SDS-PAGE10-20
IMAC15-30SDS-PAGE, Western Blot70-85
Size Exclusion5-15SDS-PAGE, SEC profile>95
Additional Polishing3-10SDS-PAGE, Mass Spec>98

Consistent quality control monitoring throughout purification using analytical SEC, dynamic light scattering, and activity assays (if available) ensures the final product meets the stringent requirements for structural and functional studies.

How can I optimize expression conditions to increase YPN_2369 yield?

Optimizing expression conditions for YPN_2369 requires systematic evaluation of multiple parameters to maximize functional protein yield. Expression temperature represents a critical variable, with lower temperatures (16-25°C) typically favoring proper folding of membrane proteins compared to standard 37°C conditions, despite slower growth rates . Induction parameters should be methodically optimized, testing various inducer concentrations (0.1-1.0 mM IPTG for T7-based systems) and induction timing (typically at mid-log phase, OD600 0.6-0.8), as premature induction can reduce yields while delayed induction may limit expression time. Media composition significantly impacts expression, with rich media (2xYT, TB) generally providing higher biomass, while defined media enables precise control and potential for isotope labeling in structural studies; supplements like glucose (0.5-1%) for catabolite repression or specific metal ions may further enhance expression. For E. coli expression, strain selection is paramount, with specialized strains like C41(DE3), C43(DE3), or Lemo21(DE3) often outperforming standard BL21(DE3) for membrane proteins due to modified membrane synthesis pathways or controlled expression rates . Codon optimization of the YPN_2369 sequence for the host organism frequently improves translation efficiency, particularly when rare codons are present in the native sequence. Fusion partners beyond affinity tags, such as MBP, SUMO, or Mistic can dramatically improve folding and membrane integration, though they require additional processing steps. The table below summarizes key optimization parameters and their effects:

Optimization ParameterRange to TestExpected EffectMeasurement Method
Temperature16°C, 20°C, 25°C, 30°CLower temperature improves foldingWestern blot, activity
IPTG Concentration0.1, 0.25, 0.5, 1.0 mMOptimal concentration balances toxicity and yieldTotal yield, Western blot
Induction OD6000.4, 0.6, 0.8, 1.0Affects cell density and expression timeFinal yield, growth curve
MediaLB, 2xYT, TB, M9Rich media increases biomassCell density, protein yield
Expression Duration4h, 8h, 16h, 24hLonger times may increase yield or degradationTime-course Western blot

A design of experiments (DOE) approach allows systematic evaluation of these factors and their interactions to identify optimal conditions with minimal experimental runs.

What analytical techniques are most informative for structural characterization of YPN_2369?

Comprehensive structural characterization of YPN_2369 membrane protein requires deploying multiple complementary analytical techniques that provide insights at different resolution levels. X-ray crystallography remains the gold standard for high-resolution structural determination, though it necessitates successful crystallization, which presents significant challenges for membrane proteins like YPN_2369 . Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for membrane proteins, enabling structural determination without crystallization and potentially capturing multiple conformational states, though it typically requires larger protein complexes for optimal results. Nuclear Magnetic Resonance (NMR) spectroscopy offers valuable information about protein dynamics and ligand interactions in solution, with 2D and 3D heteronuclear experiments providing residue-specific information, though size limitations may restrict complete structure determination of YPN_2369. Circular Dichroism (CD) spectroscopy provides crucial secondary structure content information (α-helices, β-sheets) and can monitor structural stability under varying conditions such as pH, temperature, or detergent environments. Small-Angle X-ray Scattering (SAXS) and Small-Angle Neutron Scattering (SANS) generate low-resolution envelope models in solution, particularly useful for studying oligomeric states and conformational changes. The following table summarizes these techniques and their applications to YPN_2369 characterization:

Integration of data from these complementary approaches, potentially through hybrid modeling techniques, provides the most comprehensive structural understanding of YPN_2369.

What approaches can be used to study YPN_2369 protein-lipid interactions?

Investigating YPN_2369 protein-lipid interactions requires sophisticated methodological approaches that capture both specific binding events and general membrane environment effects. Liposome binding assays provide a fundamental assessment of membrane association, using fluorescently labeled protein or liposomes containing specific lipid compositions to quantify binding through fluorescence changes or co-sedimentation approaches . Monolayer insertion techniques measure the protein's ability to penetrate lipid monolayers of varying surface pressures, providing insights into the depth and energetics of membrane insertion. Advanced biophysical approaches include surface plasmon resonance (SPR) with immobilized lipid bilayers or nanodiscs, allowing real-time measurement of association/dissociation kinetics and affinity constants for specific lipid compositions. Mass spectrometry-based techniques, particularly hydrogen-deuterium exchange mass spectrometry (HDX-MS) and native mass spectrometry, can identify specific lipid binding sites and stoichiometry, while molecular dynamics simulations complement experimental data by modeling protein-lipid interactions at atomic resolution over physiologically relevant timescales. The experimental design should systematically vary lipid compositions to determine specific lipid preferences, including the effects of head group charge, acyl chain length and saturation, and the presence of sterols or specific signaling lipids that might modulate YPN_2369 function. Reconstitution of YPN_2369 into nanodiscs or liposomes of defined composition coupled with functional assays provides a powerful approach to correlate specific lipid interactions with protein activity, contributing to a mechanistic understanding of how the membrane environment regulates this protein.

How can YPN_2369 research contribute to understanding Yersinia pestis virulence?

Research on YPN_2369 membrane protein may provide significant insights into Yersinia pestis virulence mechanisms through systematic structure-function studies and comparative genomic approaches. As a membrane protein with currently undefined function, YPN_2369 may play roles in bacterial membrane integrity, host-pathogen interactions, or environmental sensing - all critical aspects of Y. pestis pathogenicity. Structure-function studies comparing YPN_2369 from virulent and attenuated strains might reveal sequence variations that correlate with differential virulence profiles, while gene knockout studies coupled with virulence assays in appropriate models can directly assess the protein's contribution to pathogenicity. Transcriptomic and proteomic analyses under conditions mimicking host environments (different temperatures, pH values, nutrient limitations, immune challenges) would reveal expression patterns indicating potential roles during infection stages. Investigation of protein-protein interactions between YPN_2369 and known virulence factors could uncover functional relationships within virulence networks, while comparative genomic approaches examining YPN_2369 conservation and variation across Yersinia species with different host specificities and virulence profiles might identify signature patterns associated with highly pathogenic strains. The integration of structural information with phenotypic data from mutant studies could guide the development of targeted inhibitors if YPN_2369 proves essential for virulence, potentially opening new avenues for therapeutic intervention against plague, a disease that continues to present public health challenges in several regions worldwide.

How can quantitative and qualitative research methods be combined to study YPN_2369 function?

An integrated mixed-methods approach combining quantitative and qualitative research methodologies offers powerful insights into YPN_2369 function that neither approach alone could provide . Quantitative methods provide precise measurements of YPN_2369 behavior, including binding affinities calculated from surface plasmon resonance or isothermal titration calorimetry experiments, transport rates from liposome flux assays, or structural parameters from crystallography or cryo-EM studies. These approaches generate numerical data amenable to statistical analysis, hypothesis testing, and mathematical modeling of protein function . Complementary qualitative methods provide contextual understanding through techniques like electron microscopy visualization of membrane localization patterns, comparative sequence analysis identifying conserved motifs across species, or exploratory proteomics identifying interaction partners without predetermined hypotheses. The integration occurs at multiple levels: sequential integration uses qualitative findings to generate quantitative hypotheses (or vice versa), concurrent integration applies both approaches simultaneously to the same research question, and interpretive integration synthesizes findings during data analysis . A mixed-methods research design for YPN_2369 might begin with exploratory qualitative proteomics to identify potential binding partners, followed by quantitative binding assays to determine affinity constants and specificity, complemented by structural studies providing mechanistic understanding of interactions, and finally systems-level analysis of pathway perturbations when YPN_2369 is deleted or overexpressed. This comprehensive approach bridges the gap between molecular mechanisms and broader biological significance, providing a more complete understanding of YPN_2369 function than either quantitative or qualitative methods alone could achieve.

What are the key considerations for designing recombination studies of YPN_2369 across Yersinia species?

Designing recombination studies of YPN_2369 across Yersinia species requires careful consideration of sampling strategies, analytical methods, and validation approaches to generate reliable evolutionary insights. A comprehensive sampling strategy should include YPN_2369 sequences from diverse Yersinia species and strains, representing different geographical origins, host associations, and virulence profiles, with particular attention to including multiple isolates from each species to capture intraspecies variation . Sequence quality control is essential, with standardized protocols for DNA extraction, amplification, and sequencing to minimize technical artifacts, along with rigorous sequence verification through bidirectional sequencing and careful examination of chromatograms before inclusion in the dataset . Multiple complementary recombination detection methods should be employed, similar to approaches used in coronavirus studies, including programs that use different algorithms such as phylogenetic incongruence, substitution patterns, and compatibility methods, with confidence levels assigned based on detection by multiple methods . The analytical pipeline must account for how recombination events can severely skew temporal structure in evolutionary analyses, requiring careful removal of recombinant sequences or regions before conducting time-scaled phylogenetic analyses, as demonstrated in coronavirus studies where recombination led to drastically different estimates of evolutionary rates and most recent common ancestor (TMRCA) dates . Experimental validation of computational predictions should include functional characterization of recombinant and non-recombinant forms to assess phenotypic consequences, providing a bridge between sequence analysis and biological significance in the context of Yersinia evolution and host adaptation.

What are common pitfalls in experimental design when working with YPN_2369, and how can they be avoided?

Researchers working with YPN_2369 frequently encounter experimental design pitfalls that can compromise data quality and reproducibility if not properly addressed . Insufficient controls represent a primary issue, with experiments often lacking proper negative controls (empty vector expressions), positive controls (well-characterized membrane proteins), and system-specific controls that account for expression system peculiarities . Inadequate sample size and replication frequently undermine statistical power, necessitating power analysis before experimentation to determine appropriate biological and technical replicate numbers based on expected effect sizes and variability. Many studies fail to account for tag interference, where affinity or fluorescent tags may significantly alter protein behavior, requiring comparison of differently tagged constructs or tag-free proteins to verify that observed behaviors represent native protein function rather than tag artifacts . Detergent selection introduces substantial variability, as different detergents can dramatically affect protein stability, activity, and interactions; systematic screening of multiple detergent types is essential, yet often overlooked. Environmental variables like temperature, pH, and ionic strength can significantly impact membrane protein behavior but are frequently insufficiently controlled or reported, requiring standardized buffer systems with temperature control during all experimental procedures. To avoid these pitfalls, researchers should implement comprehensive experimental design protocols that include randomization of experimental runs to minimize systematic errors, blinding of analysts where possible to reduce bias, standardization of analytical methods across all experimental conditions, and detailed documentation of all experimental parameters to enable reproduction by other laboratories . Additionally, preliminary pilot studies should be conducted to identify system-specific challenges before full-scale experiments, and consultation with membrane protein specialists can provide valuable perspective on potential pitfalls specific to YPN_2369.

How can I troubleshoot low expression or poor solubility of recombinant YPN_2369?

Troubleshooting low expression or poor solubility of recombinant YPN_2369 requires a systematic approach addressing multiple aspects of protein production and extraction. For low expression levels, verify construct integrity through sequencing and expression of control proteins to confirm the expression system is functioning properly . Optimize codon usage for the host organism, particularly focusing on rare codons in the YPN_2369 sequence that might cause translational pauses. Consider fusion partners known to enhance membrane protein expression, such as MBP, SUMO, or Mistic, which can dramatically improve yields of difficult-to-express proteins . Adjust expression conditions by testing reduced temperatures (16-20°C), lower inducer concentrations, and extended expression times, as membrane proteins often benefit from slower expression rates that allow proper membrane integration. For poor solubility, evaluate multiple detergents beyond standard choices, including newer detergents like glucose neopentyl glycols (GNGs) or maltose neopentyl glycols (MNGs) that have shown success with challenging membrane proteins. Implement a systematic detergent screening approach using a panel of 8-12 detergents with different head groups and chain lengths in parallel solubilization trials, analyzing results by Western blotting and functional assays. Consider alternative solubilization strategies like styrene maleic acid lipid particles (SMALPs) that extract proteins with their native lipid environment intact, potentially preserving structure and function better than traditional detergent approaches. Optimize buffer conditions through factorial design, testing different pH values (6.5-8.5), salt concentrations (100-500 mM), and additives like glycerol, specific lipids, or stabilizing agents known to improve membrane protein solubility and stability. Monitor protein quality throughout the process using analytical techniques like size exclusion chromatography and dynamic light scattering to detect aggregation or heterogeneity that might indicate suboptimal solubilization conditions.

What emerging technologies could advance the structural and functional characterization of YPN_2369?

Emerging technologies offer unprecedented opportunities to elucidate the structural and functional properties of challenging membrane proteins like YPN_2369. Cryo-electron microscopy (cryo-EM) advancements, particularly with the development of improved direct electron detectors and image processing algorithms, now enable structural determination of membrane proteins below 100 kDa, potentially allowing YPN_2369 structures to be solved without crystallization . Microcrystal electron diffraction (MicroED) represents another promising approach, requiring only nano-sized 3D crystals that are often easier to obtain for membrane proteins than the larger crystals needed for traditional X-ray crystallography. Advanced mass spectrometry techniques, including native mass spectrometry and hydrogen-deuterium exchange mass spectrometry (HDX-MS) with improved sensitivity and resolution, can provide detailed insights into protein-ligand interactions, conformational dynamics, and protein-lipid interfaces without requiring crystallization. Single-molecule techniques such as single-molecule FRET or force spectroscopy offer unprecedented views of YPN_2369 conformational changes and dynamics at the individual molecule level, potentially revealing heterogeneity masked in ensemble measurements. CRISPR-based technologies enable precise genome editing in Yersinia pestis to introduce mutations or fluorescent tags at the endogenous YPN_2369 locus, allowing study of the protein in its native context with minimal perturbation. Integrative structural biology approaches combining data from multiple experimental sources (cryo-EM, crosslinking mass spectrometry, SAXS, NMR) with computational modeling can generate comprehensive structural models even with limited data from each individual technique. These technological advances, combined with improved membrane mimetics like nanodiscs with customizable lipid compositions, position researchers to make significant breakthroughs in understanding YPN_2369 structure, function, and biological significance in the coming years.

How might comparative studies across different Yersinia species inform YPN_2369 function?

Comparative studies of YPN_2369 across Yersinia species offer a powerful evolutionary framework for inferring protein function through analysis of sequence conservation, structural variations, and adaptive patterns. A comprehensive phylogenetic approach should analyze YPN_2369 homologs from pathogenic Yersinia species (Y. pestis, Y. pseudotuberculosis, Y. enterocolitica) and non-pathogenic relatives, generating robust phylogenetic trees to visualize evolutionary relationships and identify lineage-specific adaptations . Positive selection analysis using maximum likelihood methods (PAML, HyPhy) can identify specific amino acid residues under selective pressure, which often correspond to functionally important sites involved in host interactions, environment sensing, or adaptation to new ecological niches. Structural biology approaches comparing YPN_2369 proteins from different species might reveal conserved cores essential for basic function versus variable regions potentially involved in species-specific adaptations, with homology modeling providing preliminary structural insights when experimental structures are unavailable. Expression pattern analysis examining when and where YPN_2369 is expressed across species under standardized conditions (temperature shifts, nutrient limitation, host cell contact) can reveal conserved or divergent regulatory patterns that suggest functional roles. Complementation experiments introducing YPN_2369 variants from different species into a knockout strain provide functional tests of protein interchangeability, with success or failure indicating conserved or divergent functions respectively. Comparative protein interaction studies using techniques like affinity purification-mass spectrometry could identify species-specific interaction partners that suggest differential network integration across the Yersinia genus. These comparative approaches, integrated with recombination analysis to identify horizontally transferred segments that might confer novel functions, provide a comprehensive evolutionary perspective on YPN_2369 that complements direct functional studies and may reveal unexpected roles in Yersinia biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.