Recombinant Yersinia pestis bv. Antiqua UPF0208 membrane protein YPA_2054 (YPA_2054)

Shipped with Ice Packs
In Stock

Description

Introduction

Yersinia pestis, a bacterium responsible for plague, employs various virulence factors to infect its host. Among these factors are the Yersinia outer proteins (Yops), which play a crucial role in the bacterium's ability to suppress the host's immune responses . Recombinant Yersinia pestis bv. Antiqua UPF0208 membrane protein YPA_2054 (YPA_2054) is one such protein that has garnered attention for its potential role in virulence and as a target for therapeutic interventions.

Protein Structure and Function

Proteins are macromolecules composed of amino acids linked by peptide bonds, forming a polypeptide chain1 . These chains fold into complex three-dimensional structures, which determine their specific functions. The structure of a protein can be described at four levels: primary, secondary, tertiary, and quaternary .

Membrane proteins, like YPA_2054, are characterized by hydrophobic residues on their exterior, allowing them to interact with the lipid bilayer of cell membranes1. These proteins can be integral, spanning the membrane, or peripheral, associating with the membrane surface .

Yops and Virulence

Yersinia pestis utilizes Yops to manipulate host cell functions, suppressing immune responses and promoting bacterial survival . These proteins are encoded on a plasmid and are secreted into the host cell via a Type III secretion system (T3SS) .

YopFunction
YopECytotoxic effect on host cells, depolymerization of actin microfilaments
YopHDephosphorylation of host cell proteins
YpkASerine/threonine kinase activity
YopB/DTranslocation and sensor functions
YopNTranslocation and sensor functions
YopMInhibition of platelet aggregation
YopKControl of Yop translocation, establishment of systemic infection
YopOPrevents phagocytosis of bacteria by host cells

Functional Analysis and Research Findings

Studies have explored the functions of Yops, including their roles in cytotoxicity, immune modulation, and interference with host cell signaling pathways . For instance, YopE causes the depolymerization of actin microfilaments, while YopH dephosphorylates host cell proteins . YopM interacts with host proteins, such as α-thrombin, and modulates inflammatory responses .

Research has shown that some Yops, like YopO, have multiple functional domains that act synergistically to prevent phagocytosis by host cells . Mutants of Yersinia pseudotuberculosis expressing truncated versions of YopO were significantly less virulent in animal experiments, highlighting the importance of these domains .

Immunomodulatory Properties and Therapeutic Potential

Yops have demonstrated immunomodulatory properties, making them potential candidates for therapeutic applications . Some Yops can down-regulate anti-bacterial responses, which is essential for bacterial survival in the host . Modified or engineered Yops could be used to develop anti-inflammatory therapeutics.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPA_2054; UPF0208 membrane protein YPA_2054
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Antiqua)
Target Names
YPA_2054
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links

KEGG: ypa:YPA_2054

Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YPA_2054 and what are its basic structural characteristics?

YPA_2054 is a membrane protein from Yersinia pestis biovar Antiqua classified as an UPF0208 family protein. It is a full-length protein consisting of 151 amino acids that can be recombinantly expressed with a histidine tag . As a membrane protein, it is likely to contain hydrophobic transmembrane domains that anchor it within the bacterial cell membrane. While specific structural data for YPA_2054 is limited, membrane proteins typically exhibit alpha-helical structures traversing the lipid bilayer.

The protein's designation as UPF0208 (Uncharacterized Protein Family 0208) indicates that its precise function has not been fully elucidated, representing an opportunity for novel research characterization.

How can YPA_2054 be successfully expressed and purified for research studies?

YPA_2054 can be recombinantly expressed in E. coli expression systems using a histidine tag for purification . For optimal expression:

  • Vector selection: Use expression vectors containing strong promoters (T7, tac) with appropriate tags (His-tag) for downstream purification.

  • Expression conditions optimization:

    • Test multiple E. coli strains (BL21(DE3), Rosetta, C41/C43)

    • Optimize induction parameters (temperature, IPTG concentration, induction time)

    • Consider using specialized media formulations for membrane protein expression

  • Purification protocol:

    • Membrane fraction isolation via differential centrifugation

    • Solubilization using appropriate detergents (DDM, LDAO, or OG)

    • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag

    • Size exclusion chromatography for final polishing

This approach is consistent with established protocols for recombinant membrane proteins, though specific optimization may be required for maximal yield and activity preservation.

What experimental approaches can determine the membrane topology of YPA_2054?

Determining membrane topology requires multiple complementary approaches:

  • Computational prediction:

    • TMHMM, HMMTOP, or Phobius for transmembrane domain prediction

    • Signal peptide prediction using SignalP

  • Reporter fusion approaches:

    • PhoA (alkaline phosphatase) fusion: Active in periplasm, inactive in cytoplasm

    • GFP fusion: Fluorescent in cytoplasm, non-fluorescent in periplasm

    • Construct a library of truncations fused to these reporters

  • Protease accessibility:

    • Selective permeabilization of outer membrane

    • Limited proteolysis with proteinase K

    • Western blot analysis with domain-specific antibodies

  • Cysteine scanning mutagenesis:

    • Introduce cysteine residues at various positions

    • Assess accessibility to membrane-impermeable sulfhydryl reagents

These methodologies help map which segments of YPA_2054 span the membrane and which domains are exposed to either the cytoplasmic or periplasmic faces, providing crucial structural information for functional studies.

How might YPA_2054 contribute to Yersinia pestis pathogenicity?

YPA_2054's role in pathogenicity requires systematic investigation through multiple approaches:

  • Gene knockout/knockdown studies:

    • Generate YPA_2054 deletion mutants

    • Evaluate phenotypic changes in virulence models

    • Complement with wild-type gene to confirm specificity

  • Host-pathogen interaction assays:

    • Adhesion to host cell lines

    • Invasion efficiency compared to wild-type

    • Intracellular survival assays

  • Immune response evaluation:

    • Cytokine production profiles

    • Neutrophil recruitment and activation

    • Macrophage phagocytosis assays

This approach is particularly relevant given that Yersinia pestis is a significant human pathogen responsible for bubonic plague, with numerous membrane proteins involved in virulence mechanisms and host immune evasion . As an uncharacterized membrane protein, YPA_2054 could potentially participate in cellular processes critical for pathogenicity such as adhesion, invasion, or secretion systems.

What experimental design considerations are most important when studying YPA_2054 function in vitro?

Effective experimental design for studying YPA_2054 function should incorporate these principles:

  • Appropriate controls:

    • Positive and negative controls for each assay

    • Wild-type vs. mutant comparisons

    • Empty vector controls

    • Blocking controls to validate specificity

  • Blocking design to minimize variability:

    • Group similar experimental units together

    • Reduce variability within each block

    • Enhance detection of treatment effects

  • Replication strategy:

    • True biological replicates (not pseudo-replication)

    • Technical replicates to control for measurement error

    • Power analysis to determine adequate sample size

  • Protein stability considerations:

    • Optimize buffer conditions (pH, salt, detergents)

    • Temperature sensitivity assessment

    • Storage condition validation

  • Functional reconstitution:

    • Liposome incorporation

    • Planar lipid bilayers

    • Nanodiscs for maintaining native-like environment

By implementing these design elements, researchers can minimize bias, prevent confounding variables, and obtain reliable, reproducible results when investigating YPA_2054 function .

How can researchers identify potential protein-protein interactions involving YPA_2054?

To systematically identify protein interaction partners of YPA_2054:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged YPA_2054 in Yersinia pestis

    • Crosslink if interactions are transient

    • Immunoprecipitate using tag-specific antibodies

    • Identify binding partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Construct YPA_2054 bait plasmids

    • Screen against genomic prey libraries

    • Validate positive interactions with targeted assays

  • Pull-down assays:

    • Express recombinant His-tagged YPA_2054

    • Incubate with bacterial lysate

    • Identify binding partners via mass spectrometry

  • In situ proximity labeling:

    • Fusion with BioID or APEX2

    • Express in native context

    • Identify proximal proteins through biotinylation

  • Surface plasmon resonance (SPR):

    • Immobilize purified YPA_2054

    • Test binding with candidate partners

    • Determine kinetic parameters

These approaches could reveal whether YPA_2054 participates in complexes related to membrane stability, transport, signaling, or virulence, providing insights into its biological function.

How do small-residue packing motifs potentially influence YPA_2054 structure and function?

Small-residue packing motifs like GxxxG, AxxxA, or SxxxS could significantly impact YPA_2054 structure and function:

  • Sequence analysis approach:

    • Scan YPA_2054 sequence for small-residue motifs

    • Compare conservation across Yersinia species

    • Identify potential helix-helix interaction sites

  • Mutagenesis strategy:

    • Generate alanine scanning mutants

    • Substitute small residues with bulkier amino acids

    • Assess impact on protein folding and stability

  • Structural impact analysis:

    • Circular dichroism to measure secondary structure changes

    • Thermal stability assays to assess folding robustness

    • Blue native PAGE to analyze oligomeric state changes

Research on artificial membrane proteins has demonstrated that simple sequence motifs containing small residues (G, S, A) can rigidify membrane protein structures, enhancing their stability and functional properties . These motifs facilitate close helix packing through "knobs-into-holes" interactions. YPA_2054 analysis might reveal similar structural principles governing its membrane integration and potential oligomerization.

What techniques can elucidate the potential role of YPA_2054 in cofactor binding or enzymatic activity?

Investigating YPA_2054's potential for cofactor binding or enzymatic activity requires:

  • Cofactor binding screening:

    • Spectroscopic screening with diverse cofactors (hemes, flavins, metal ions)

    • Isothermal titration calorimetry for binding parameters

    • Differential scanning fluorimetry to detect stabilization upon cofactor binding

  • Activity assays based on protein family:

    • Generic enzymatic screens (hydrolase, oxidoreductase)

    • Membrane-specific functions (transport, channel activity)

    • Lipid interaction assays

  • Structural analysis with bound cofactors:

    • X-ray crystallography of protein-cofactor complex

    • Cryo-EM structure determination

    • NMR for dynamic interaction information

Research on artificial membrane proteins has shown that even minimally designed proteins can bind cofactors like heme and develop nascent enzymatic activities such as peroxidase function . Investigating whether YPA_2054 has similar capabilities could provide insights into its native function and potential biotechnological applications.

How can researchers assess the impact of membrane composition on YPA_2054 stability and function?

To systematically evaluate membrane composition effects:

  • Reconstitution in defined lipid systems:

    • Prepare liposomes with varying lipid compositions

    • Incorporate purified YPA_2054

    • Assess protein orientation and integration efficiency

  • Membrane fluidity effects:

    • Vary cholesterol/ergosterol content

    • Modulate fatty acid saturation levels

    • Measure protein lateral mobility using FRAP

  • Native membrane mimetics:

    • Extract native Yersinia membranes

    • Reconstitute YPA_2054 in native vs. synthetic lipids

    • Compare structural and functional parameters

  • Lipid-protein interaction mapping:

    • Lipid photocrosslinking

    • Hydrogen-deuterium exchange mass spectrometry

    • Molecular dynamics simulations

This approach recognizes that membrane proteins function within the context of their lipid environment, which can significantly impact their structural integrity, oligomerization state, and functional properties.

What strategies can overcome expression and purification challenges specific to YPA_2054?

Addressing common membrane protein expression challenges for YPA_2054:

ChallengeStrategic SolutionMethodology
Toxicity to expression hostTight expression controlUse tunable promoters; glucose repression; lower temperature
Inclusion body formationSolubility enhancementFusion tags (MBP, SUMO); co-expression with chaperones
Low yieldExpression system optimizationTest insect cells, mammalian cells, cell-free systems
Detergent compatibilityDetergent screeningSystematic testing of different detergent classes; stability assays
Functional loss during purificationNative-like environmentNanodiscs; amphipols; SMALPs for extraction

Implementing a systematic screening approach across these parameters increases the likelihood of obtaining properly folded, functional YPA_2054 for downstream analyses.

How can researchers apply structural biology techniques to investigate YPA_2054 despite the challenges of membrane protein crystallization?

Modern structural biology offers multiple approaches for YPA_2054 characterization:

  • X-ray crystallography optimization:

    • Lipidic cubic phase crystallization

    • Detergent screening for crystal formation

    • Antibody-mediated crystallization

    • Fusion protein approaches (T4 lysozyme, BRIL)

  • Cryo-electron microscopy:

    • Single-particle analysis for oligomeric complexes

    • Tomography for membrane-embedded contexts

    • Subtomogram averaging for structural determination

  • NMR spectroscopy approaches:

    • Solution NMR for detergent-solubilized protein

    • Solid-state NMR for membrane-embedded samples

    • Selective isotope labeling for specific domain analysis

  • Integrative structural biology:

    • Combine low-resolution techniques (SAXS, SANS)

    • Cross-linking mass spectrometry for distance constraints

    • Computational modeling with experimental restraints

These complementary techniques can overcome the inherent challenges in membrane protein structural biology, providing insights into YPA_2054's three-dimensional architecture and potential functional sites.

What computational approaches can predict functional sites and evolutionary relationships for YPA_2054?

Computational analyses provide valuable insights when experimental data is limited:

  • Homology detection beyond sequence similarity:

    • Profile Hidden Markov Models

    • Fold recognition algorithms

    • Contact prediction through coevolution analysis

  • Functional site prediction:

    • Conservation analysis across orthologs

    • 3D clustering of conserved residues

    • Machine learning approaches for functional site detection

  • Structural modeling pipeline:

    • Template identification and selection

    • Model building with membrane-specific restraints

    • Energy minimization in implicit membrane

    • Validation through evolutionary conservation

  • Molecular dynamics simulations:

    • Stability assessment in membrane environment

    • Conformational flexibility analysis

    • Potential ligand binding site identification

These methods can generate testable hypotheses about YPA_2054 function and evolution, guiding experimental design and interpretation of results.

How does YPA_2054 research contribute to understanding Yersinia pestis survival mechanisms in host environments?

YPA_2054 research provides insights into pathogen survival through:

  • Host environment adaptation studies:

    • Expression analysis under host-mimicking conditions

    • Role in acid/oxidative stress resistance

    • Contribution to antimicrobial peptide resistance

  • Intracellular survival assessment:

    • Macrophage infection models

    • Tracking YPA_2054 expression during phagocytosis

    • Knockout impact on intracellular persistence

  • In vivo relevance:

    • Animal infection models with YPA_2054 mutants

    • Competitive index assays with wild-type

    • Tissue-specific expression patterns

Yersinia pestis employs sophisticated mechanisms to evade host defenses and establish infection . As a membrane protein, YPA_2054 may contribute to maintaining membrane integrity under hostile host conditions or participate in specialized functions required for pathogen survival and proliferation within host tissues.

What methodological approaches can determine if YPA_2054 represents a viable antimicrobial target?

To evaluate YPA_2054 as a potential therapeutic target:

  • Essentiality assessment:

    • Conditional knockout systems

    • CRISPR interference for titratable repression

    • Growth phenotype analysis in various conditions

  • Druggability evaluation:

    • Structural analysis of potential binding pockets

    • Fragment-based screening

    • Computational ligand docking

  • Functional inhibition effects:

    • Antibody-mediated inhibition

    • Peptide inhibitors targeting exposed domains

    • Small molecule screening using activity assays

  • Target validation framework:

    • In vitro activity confirmation

    • Ex vivo infection model testing

    • In vivo efficacy assessment

    • Resistance development monitoring

These approaches follow established target validation pipelines, adapted specifically for membrane proteins which often represent excellent antibiotic targets due to their accessibility and essential functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.