Recombinant Yersinia pestis bv. Antiqua UPF0208 membrane protein YpAngola_A1824 (YpAngola_A1824)

What is YpAngola_A1824 and what is its significance in Yersinia research?

YpAngola_A1824 is a UPF0208 family membrane protein found in Yersinia pestis biovar Antiqua, comprising 151 amino acids. This protein belongs to a family of uncharacterized proteins with predicted membrane localization. The significance of this protein lies in understanding the membrane biology of Y. pestis, the causative agent of plague, which remains an important pathogen for both historical analysis and modern biodefense research. The protein's full amino acid sequence has been identified as: MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLTWQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAVAPIEPIPTYQSLADLLKRAFKQLDKTFLDDL .

How is recombinant YpAngola_A1824 protein typically produced for research purposes?

Recombinant YpAngola_A1824 protein is typically produced using E. coli expression systems with an N-terminal histidine tag to facilitate purification. The full-length coding sequence (1-151 amino acids) is cloned into an appropriate expression vector and transformed into competent E. coli cells. Following induction of protein expression, the cells are lysed, and the recombinant protein is purified using affinity chromatography (typically Ni-NTA for His-tagged proteins). The protein is then subjected to quality control testing, including SDS-PAGE analysis to confirm purity (>90%), before being lyophilized for storage and distribution .

For effective protein expression, researchers should optimize:

• Expression strain selection (BL21, Rosetta, etc.)

• Induction conditions (temperature, IPTG concentration, duration)

• Lysis buffer composition for membrane protein solubilization

• Purification strategy to reduce contaminants

What are the recommended storage and handling conditions for YpAngola_A1824?

The recombinant YpAngola_A1824 protein should be stored following these methodological guidelines:

• Storage temperature: -20°C to -80°C for long-term preservation

• Reconstitution protocol: Prior to opening, briefly centrifuge the vial to collect contents at the bottom

• Reconstitution medium: Deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Stability enhancement: Addition of 5-50% glycerol (final concentration) is recommended, with 50% being optimal for long-term storage

• Aliquoting: To prevent protein degradation from multiple freeze-thaw cycles, create working aliquots

• Short-term handling: Working aliquots may be stored at 4°C for up to one week

• Buffer composition: The protein is supplied in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Repeated freeze-thaw cycles should be strictly avoided to maintain protein integrity and activity.

What are appropriate experimental approaches for studying the membrane localization of YpAngola_A1824?

When investigating the membrane localization of YpAngola_A1824, researchers should implement a multi-methodological approach:

• Subcellular Fractionation: Separate bacterial cellular components through differential centrifugation, followed by western blot analysis using anti-His antibodies to detect the recombinant protein in membrane fractions.

• Fluorescence Microscopy:

  • Express YpAngola_A1824 fused with fluorescent proteins (GFP, mCherry)

  • Employ membrane-specific dyes as counterstains

  • Use confocal microscopy for high-resolution localization analysis

• Protease Accessibility Assays: Determine protein topology by exposing intact cells or membrane vesicles to proteases, followed by analysis of protected fragments.

• Immunogold Electron Microscopy: For nanometer-scale resolution to precisely localize the protein within membrane structures.

When designing these experiments, apply the quality research methodology principles outlined in contemporary research methodology frameworks, ensuring proper controls and replicability for each approach 4.

What analytical techniques are most effective for characterizing the structural properties of YpAngola_A1824?

For comprehensive structural characterization of YpAngola_A1824, researchers should implement these methodological approaches:

• Circular Dichroism (CD) Spectroscopy:

  • Far-UV CD (190-250 nm): Determine secondary structure composition (α-helices, β-sheets)

  • Near-UV CD (250-350 nm): Examine tertiary structure fingerprint

• Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • 2D HSQC experiments for structural fingerprinting

  • 3D experiments for residue-specific assignments

• X-ray Crystallography:

  • Requires optimization of crystallization conditions for membrane proteins

  • May need detergent screening or lipidic cubic phase approaches

• Cryo-Electron Microscopy:

  • Single-particle analysis for potential oligomeric states

  • Provides structural data without crystallization

• Molecular Dynamics Simulations:

  • Model protein behavior in membrane environments

  • Predict structural flexibility and potential functional sites

For membrane proteins like YpAngola_A1824, the methodology should address challenges of protein stability in detergent micelles or lipid bilayers, which may require specialized approaches such as nanodiscs or amphipols to maintain native structure during analysis4.

How can researchers verify the functional integrity of purified recombinant YpAngola_A1824?

To verify functional integrity of purified recombinant YpAngola_A1824, researchers should implement a multi-faceted quality assessment strategy:

• Biophysical Characterization:

  • Size-exclusion chromatography to verify monodispersity and oligomeric state

  • Dynamic light scattering to assess aggregation state

  • Thermal shift assays to determine stability and proper folding

• Lipid Binding Assays:

  • Liposome flotation assays to confirm membrane association

  • Monolayer penetration experiments to measure lipid interaction kinetics

  • Surface plasmon resonance with immobilized lipids

• Functional Reconstitution:

  • Incorporation into proteoliposomes or nanodiscs

  • Assessment of membrane integrity using dye leakage assays

  • Ion flux measurements if channel activity is suspected

• Interactome Analysis:

  • Pull-down assays to identify interaction partners

  • Crosslinking mass spectrometry to map protein-protein interactions

  • Bacterial two-hybrid system to verify specific interactions

When analyzing the data, researchers should apply appropriate statistical methods to discriminate between specific and non-specific interactions, establishing proper controls with unrelated membrane proteins of similar size and topology4.

What methodological approaches are suitable for investigating the role of YpAngola_A1824 in Yersinia pathogenesis?

Investigating YpAngola_A1824's role in Yersinia pathogenesis requires sophisticated experimental designs that bridge molecular mechanisms with pathogenicity outcomes:

• Gene Knockout and Complementation Studies:

  • Create clean deletion mutants of YpAngola_A1824 using allelic exchange

  • Generate complementation strains with wild-type and site-directed mutants

  • Compare phenotypes under various growth conditions and stressors

• Infection Models:

  • Cellular models: Macrophage infection assays measuring bacterial survival

  • Invertebrate models: Caenorhabditis elegans or Galleria mellonella

  • Mammalian models: Mouse infection models with wild-type and mutant strains

• Transcriptomic and Proteomic Profiling:

  • RNA-Seq to compare global expression differences between wild-type and mutant

  • Quantitative proteomics to identify altered protein levels

  • Secretome analysis to detect changes in protein secretion

• Virulence Factor Interaction Studies:

  • Co-immunoprecipitation with known virulence factors

  • Bacterial two-hybrid assays to identify protein-protein interactions

  • Localization studies during infection using immunofluorescence microscopy

For data analysis, researchers should employ multivariate statistical approaches to correlate molecular phenotypes with pathogenicity outcomes, and consider using the multiperspectival approach described in contemporary research methodology literature to integrate different data types .

How can comparative genomics and structural bioinformatics be utilized to understand the evolution and function of YpAngola_A1824?

A comprehensive approach to understanding YpAngola_A1824 through comparative genomics and structural bioinformatics should include:

• Homology Identification and Phylogenetic Analysis:

  • BLAST searches against diverse bacterial genomes

  • Multiple sequence alignment of homologs using MUSCLE or MAFFT

  • Construction of phylogenetic trees using maximum likelihood methods

  • Analysis of selection pressure using dN/dS ratios

• Structural Prediction and Analysis:

  • Secondary structure prediction using PSIPRED or JPred

  • Transmembrane topology prediction using TMHMM or MEMSAT

  • 3D structure modeling using AlphaFold2 or SWISS-MODEL

  • Molecular dynamics simulations in membrane environments

• Functional Inference:

  • Conservation analysis of specific residues across homologs

  • Identification of functional domains and motifs

  • Co-evolution analysis to identify interaction partners

  • Genomic context analysis examining neighboring genes

• Integrated Analysis Framework:

The methodology should integrate these diverse data types using machine learning approaches to develop testable hypotheses about protein function, applying the multiperspectival approach to synthesize findings from diverse analytical perspectives .

What sophisticated techniques can be employed to study the membrane topology and oligomerization state of YpAngola_A1824?

Advanced researchers investigating membrane topology and oligomerization of YpAngola_A1824 should implement these state-of-the-art methodological approaches:

• Cysteine Scanning Mutagenesis and Accessibility:

  • Systematically replace residues with cysteine throughout the sequence

  • Probe accessibility with membrane-permeable and -impermeable thiol-reactive reagents

  • Map topology based on labeling patterns

  • Quantitative analysis using mass spectrometry to determine labeling efficiency

• Advanced Fluorescence Techniques:

  • Förster Resonance Energy Transfer (FRET) to measure distances between domains

  • Fluorescence Recovery After Photobleaching (FRAP) to assess mobility

  • Single-molecule tracking to examine dynamics in native membranes

  • Fluorescence Cross-Correlation Spectroscopy (FCCS) to detect oligomerization

• Mass Spectrometry-Based Approaches:

  • Chemical crosslinking mass spectrometry (XL-MS) to identify interaction interfaces

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify exposed regions

  • Native mass spectrometry to determine oligomeric states

• Advanced Microscopy Methods:

  • Super-resolution microscopy (STORM, PALM) for nanoscale localization

  • Correlative light and electron microscopy (CLEM) to connect function with structure

  • Atomic force microscopy of membrane-embedded proteins

Data analysis should include multivariate statistical approaches and machine learning algorithms to integrate diverse datasets and detect patterns that may not be evident through conventional analysis4.

What are the common challenges in expressing and purifying membrane proteins like YpAngola_A1824, and how can they be addressed?

Membrane proteins present unique challenges in expression and purification. For YpAngola_A1824, researchers should address these challenges through methodical optimization:

• Low Expression Yields:

  • Optimize codon usage for E. coli expression

  • Test multiple promoter strengths (T7, tac, ara)

  • Evaluate different E. coli strains (C41/C43 for membrane proteins)

  • Reduce expression temperature (16-20°C) to allow proper folding

  • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

• Protein Aggregation:

  • Screen multiple detergents (DDM, LMNG, CHAPS)

  • Test detergent mixtures for improved solubilization

  • Implement systematic detergent-to-protein ratio optimization

  • Consider amphipols or nanodiscs for improved stability

• Purification Challenges:

  • Optimize lysis conditions (mechanical vs. chemical)

  • Implement two-phase purification (affinity + size exclusion)

  • Test on-column detergent exchange methods

  • Consider lipid addition during purification

• Quality Control Framework:

When implementing these strategies, researchers should use a step-wise optimization approach, changing one variable at a time while maintaining detailed records to identify successful conditions 4.

How should researchers approach contradictory results when studying membrane protein function and interactions?

When facing contradictory results in YpAngola_A1824 research, implement this systematic resolution methodology:

• Methodological Validation:

  • Cross-validate findings using orthogonal techniques

  • Evaluate methodology for potential artifacts or limitations

  • Implement controls specific to each technique used

  • Consider membrane mimetic effects on protein behavior

• Biological Context Reconciliation:

  • Evaluate differences in experimental conditions (pH, salt, temperature)

  • Consider regulation by post-translational modifications

  • Assess cellular context differences (in vitro vs. in vivo)

  • Examine protein concentration effects on oligomerization states

• Data Integration Framework:

  • Apply Bayesian statistical approaches to evaluate conflicting datasets

  • Implement multivariate analysis to identify condition-dependent factors

  • Use machine learning to detect patterns across experimental conditions

  • Develop computational models that can reconcile seemingly contradictory data

• Systematic Resolution Approach:

  • Formulate specific hypotheses that could explain discrepancies

  • Design discriminating experiments to test competing hypotheses

  • Implement the multiperspectival approach to integrate diverse viewpoints

  • Document all methodological details for complete transparency

Scientists should recognize that apparent contradictions often reveal important biological insights about condition-dependent protein behavior, especially for membrane proteins whose function may depend on lipid environment, oligomerization state, or interaction partners that vary between experimental systems 4.

What advanced data analysis approaches should be used when investigating membrane protein dynamics and conformational changes?

Advanced data analysis for membrane protein dynamics and conformational changes of YpAngola_A1824 requires sophisticated computational and statistical approaches:

• Molecular Dynamics Analysis:

  • Principal Component Analysis (PCA) to identify major conformational motions

  • Time-lagged Independent Component Analysis (tICA) to detect slow conformational changes

  • Markov State Models (MSMs) to identify metastable conformational states

  • Network analysis to identify allosteric communication pathways

• Spectroscopic Data Integration:

  • Bayesian inference methods to fit experimental data to structural models

  • Ensemble refinement approaches combining multiple data sources

  • Maximum entropy methods to determine conformational distributions

  • Cross-correlation analysis between different spectroscopic techniques

• Multivariate Statistical Approaches:

  • Partial Least Squares (PLS) regression to correlate structure with function

  • Canonical Correlation Analysis (CCA) to relate multiple datasets

  • Hierarchical clustering to identify conformational families

  • Random Forest algorithms for feature importance in conformational changes

• Integrated Analysis Framework:

  • Develop custom Python/R scripts for specialized analysis

  • Implement Bayesian statistical frameworks for hypothesis testing

  • Use dimensionality reduction techniques to visualize complex datasets

  • Apply deep learning approaches for pattern recognition in time-series data

Researchers should implement reproducible computational workflows that document all analysis parameters, making use of notebooks (Jupyter, R Markdown) to ensure transparent and reproducible data analysis, following the methodological rigor emphasized in contemporary research methodology literature 4.

What emerging technologies could advance our understanding of membrane proteins like YpAngola_A1824?

Emerging technologies offer unprecedented opportunities to expand our understanding of YpAngola_A1824 through methodological innovations:

• Cryo-Electron Tomography:

  • Visualize protein in native membrane environments

  • Study oligomeric assemblies in cellular context

  • Examine protein localization and distribution patterns

  • Combine with subtomogram averaging for high-resolution insights

• Advanced Mass Spectrometry:

  • Native mass spectrometry in membrane mimetics

  • Ion mobility-mass spectrometry for conformational states

  • Top-down proteomics for complete protein characterization

  • Crosslinking mass spectrometry for interaction mapping

• Single-Molecule Techniques:

  • Single-molecule FRET for conformational dynamics

  • Optical tweezers for mechanical property measurements

  • Nanopore recordings for channel activity (if applicable)

  • Single-molecule tracking in live bacteria

• Computational Advances:

  • AI-driven structure prediction with AlphaFold for membrane proteins

  • Enhanced sampling methods for lipid-protein interactions

  • Coarse-grained simulations for long-timescale dynamics

  • Quantum mechanics/molecular mechanics for catalytic mechanisms

• Genetic Technologies:

  • CRISPR interference for conditional knockdowns

  • Proximity labeling (BioID, APEX) for in vivo interactome

  • High-throughput mutagenesis with deep sequencing readouts

  • Optogenetic control of protein function

Researchers should consider how these emerging methodologies can be integrated through multiperspectival approaches to develop a comprehensive understanding of membrane protein biology that transcends the limitations of individual techniques .

How can systems biology approaches be applied to understand the role of YpAngola_A1824 in the broader context of Yersinia biology?

Systems biology offers powerful frameworks for contextualizing YpAngola_A1824 within the broader biological systems of Yersinia:

• Multi-omics Integration:

  • Combine transcriptomics, proteomics, metabolomics, and lipidomics data

  • Implement network analysis to position YpAngola_A1824 in cellular pathways

  • Apply Bayesian network inference to discover regulatory relationships

  • Develop genome-scale metabolic models to predict functional impacts

• Protein Interaction Networks:

  • Conduct large-scale protein-protein interaction screens

  • Map genetic interactions through synthetic genetic arrays

  • Apply network centrality measures to assess functional importance

  • Identify condition-specific interaction hubs

• Computational Modeling Approaches:

  • Develop ordinary differential equation models of relevant pathways

  • Implement constraint-based modeling for metabolic predictions

  • Apply agent-based modeling for host-pathogen interactions

  • Utilize Boolean network models for regulatory circuit analysis

• Integrated Experimental Design:

  • Perturbation experiments with multiple readouts

  • Time-series analyses across environmental conditions

  • In vivo imaging with multiplexed reporters

  • Host-pathogen interaction dynamics studies

The implementation of these approaches should follow the multiperspectival methodology, integrating diverse data types and analytical frameworks to develop comprehensive models of how YpAngola_A1824 functions within the broader biological context of Yersinia pestis .