Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YPA_1696 (YPA_1696)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPA_1696; UPF0283 membrane protein YPA_1696
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Antiqua)
Target Names
YPA_1696
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links

KEGG: ypa:YPA_1696

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the UPF0283 membrane protein YPA_1696 and what is its significance in Yersinia pestis research?

The UPF0283 membrane protein YPA_1696 is a membrane-associated protein from Yersinia pestis biovar Antiqua with a full length of 353 amino acids. The "UPF0283" designation indicates it belongs to an uncharacterized protein family, suggesting its function remains incompletely understood. This protein is significant in Yersinia pestis research because membrane proteins often play crucial roles in pathogen-host interactions, environmental adaptation, and virulence mechanisms.

The study of YPA_1696 contributes to our understanding of Y. pestis physiology and potentially its pathogenesis. Y. pestis is the causative agent of plague, a disease that has caused millions of deaths throughout history and remains a concern for public health and biosecurity . Membrane proteins like YPA_1696 may be involved in the bacterium's adaptation to different hosts (mammalian and flea vectors) and environmental conditions.

What expression systems are most effective for producing recombinant YPA_1696 protein?

Based on current research protocols, Escherichia coli expression systems have proven effective for the recombinant production of YPA_1696. Specifically, the protein has been successfully expressed in E. coli with an N-terminal His-tag . This approach facilitates purification through affinity chromatography while maintaining protein functionality.

When expressing membrane proteins like YPA_1696, researchers should consider the following methodological factors:

  • Expression vector selection: Vectors with tightly regulated promoters (such as T7 or tac) allow controlled expression, which is crucial for membrane proteins that can be toxic when overexpressed.

  • Host strain selection: E. coli strains like BL21(DE3), C41(DE3), or C43(DE3) are often preferred for membrane protein expression due to their tolerance for potentially toxic proteins.

  • Growth conditions: Lower temperatures (16-25°C) during induction often improve proper folding and reduce inclusion body formation.

  • Induction parameters: Lower IPTG concentrations (0.1-0.5 mM) and longer induction times may improve yield and quality of membrane proteins.

How does temperature affect the expression of UPF0283 membrane proteins in Yersinia pestis?

Temperature regulation is a critical factor in Y. pestis protein expression and function. While specific data for YPA_1696 is limited, research on other Y. pestis proteins provides valuable insights that may apply to this membrane protein. For instance, the capsular F1 antigen shows temperature-dependent expression, being produced at 37°C but only minimally at 27°C . This temperature-dependent regulation is a key feature of Y. pestis adaptation between its flea vector (lower temperature) and mammalian host (higher temperature) environments.

For YPA_1696, researchers should consider:

  • Examining expression patterns at both flea-relevant (20-25°C) and mammalian-relevant (37°C) temperatures to understand potential temperature-dependent regulation.

  • When expressing recombinant YPA_1696, temperature optimization is crucial as the genetic features affected by temperature in Y. pestis may operate similarly in recombinant expression systems .

  • Temperature shifts might trigger conformational changes or alter protein-protein interactions, which could be relevant to the protein's function during host switching.

What purification strategies yield the highest purity and functional integrity of recombinant YPA_1696?

Purification of membrane proteins like YPA_1696 requires specialized approaches to maintain their functional integrity. Based on established methodologies for similar proteins, an effective purification strategy would include:

  • Membrane isolation and solubilization:

    • Cell disruption by sonication or French press

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin

  • Affinity chromatography:

    • For His-tagged YPA_1696, immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins

    • Buffer optimization with detergent above critical micelle concentration (CMC)

    • Gradual elution with imidazole gradient (20-500 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Ion exchange chromatography for further purification if necessary

  • Quality control assessments:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Circular dichroism to assess secondary structure integrity

    • Dynamic light scattering to evaluate homogeneity

Optimizing detergent concentration is particularly critical for maintaining the functional integrity of membrane proteins throughout the purification process.

How can researchers validate the structural integrity of purified recombinant YPA_1696?

Validating the structural integrity of membrane proteins like YPA_1696 requires a combination of biophysical and biochemical techniques:

When interpreting results, researchers should consider that the recombinant version with a His-tag might have slight structural differences compared to the native protein.

What is the current understanding of the physiological role of UPF0283 membrane protein in Yersinia pestis?

  • Environmental adaptation: The protein may be involved in sensing or responding to environmental changes during the transition between flea vector and mammalian host, particularly given the temperature-dependent regulation observed in other Y. pestis proteins .

  • Stress response: Membrane proteins often participate in stress response mechanisms. Y. pestis encounters various stresses during infection, including temperature shifts, pH changes, nutritional limitations, and host immune defenses .

  • Transport functions: Many membrane proteins serve as transporters or channels for nutrients, ions, or signaling molecules, which could be essential for Y. pestis survival in different host environments.

  • Virulence regulation: The protein might participate in regulating virulence factor expression or function, possibly through signaling pathways or direct interactions with host cells.

Research approaches to elucidate its function could include comparative genomics across Yersinia species, gene knockout studies combined with phenotypic assays, protein-protein interaction studies, and transcriptomic analysis under various conditions.

How does the YPA_1696 protein potentially contribute to the virulence of Yersinia pestis?

While direct evidence linking YPA_1696 to Y. pestis virulence is not established in the provided search results, several methodological approaches can be used to investigate this relationship:

  • Genetic manipulation studies:

    • Generation of YPA_1696 deletion mutants and assessment of virulence in animal models

    • Complementation studies to confirm phenotypes are specifically due to YPA_1696

    • Conditional expression systems to study temporal requirements during infection

  • Expression pattern analysis:

    • Examination of YPA_1696 expression levels during different stages of infection

    • Determination if expression is regulated by known virulence regulators (e.g., PhoP, OmpR, Fur)

    • Analysis of expression in response to host-derived signals

  • Host interaction studies:

    • Investigation of interactions with host immune components

    • Assessment of the protein's role in immune evasion mechanisms

    • Evaluation of contribution to resistance against host antimicrobial peptides

  • Comparative analysis:

    • Comparison of YPA_1696 sequence and expression between virulent and attenuated Y. pestis strains

    • Examination of homologs in related pathogens and their virulence contributions

The understanding of Y. pestis virulence mechanisms indicates complex regulation involving numerous factors that are responsive to environmental stresses and multiple regulatory proteins . Integration of YPA_1696 into this regulatory network would provide insights into its potential contribution to virulence.

What experimental approaches are most effective for studying YPA_1696 protein-protein interactions?

Investigating protein-protein interactions involving membrane proteins like YPA_1696 requires specialized approaches that accommodate their hydrophobic nature and membrane environment:

  • In vivo approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Protein-fragment complementation assays (PCA)

    • In vivo crosslinking followed by co-immunoprecipitation

    • FRET-based interaction studies using fluorescent protein fusions

  • In vitro approaches:

    • Pull-down assays using purified His-tagged YPA_1696

    • Surface plasmon resonance (SPR) with the protein reconstituted in nanodiscs

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

    • Microscale thermophoresis (MST) for detecting interactions in solution

  • Large-scale screening:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Protein microarrays containing potential Y. pestis interacting partners

    • Proximity-dependent biotin identification (BioID) adapted for bacterial systems

  • Computational approaches:

    • Prediction of interaction partners based on co-expression data

    • Structural modeling of potential interactions

    • Evolutionary coupling analysis to identify co-evolving residues

For membrane proteins, maintaining the native membrane environment or suitable mimetics (detergent micelles, nanodiscs, or liposomes) is crucial for preserving physiologically relevant interactions.

How can researchers investigate the role of YPA_1696 in temperature-dependent adaptation processes?

Given the importance of temperature sensing in Y. pestis life cycle transitions between flea vectors (20-25°C) and mammalian hosts (37°C), investigating YPA_1696's potential role in temperature adaptation requires systematic approaches:

  • Expression analysis across temperatures:

    • Quantitative RT-PCR to measure YPA_1696 transcript levels at different temperatures

    • Western blotting to assess protein levels and potential post-translational modifications

    • Reporter gene fusions to monitor expression patterns in real-time during temperature shifts

  • Structural and functional changes with temperature:

    • Circular dichroism spectroscopy at different temperatures to detect conformational changes

    • Differential scanning calorimetry to determine thermal stability parameters

    • Functional assays performed across a temperature gradient to identify optimal conditions

  • Genetic approaches:

    • Construction of temperature-sensitive mutants through site-directed mutagenesis

    • Complementation studies at different temperatures

    • Global transcriptomic and proteomic analysis of wildtype versus YPA_1696 mutants during temperature shifts

  • Temperature-dependent protein interactions:

    • Co-immunoprecipitation experiments conducted at different temperatures

    • Bacterial two-hybrid screening at both 25°C and 37°C

    • Crosslinking studies at various temperatures to capture transient interactions

Research on other Y. pestis proteins has shown that temperature regulation affects the expression of virulence factors, including capsular antigens . Similar mechanisms might apply to YPA_1696, potentially linking it to the bacterium's adaptation during host switching.

What methodological approaches can be used to study the contribution of YPA_1696 to host-pathogen interactions?

Investigating YPA_1696's role in host-pathogen interactions requires multidisciplinary approaches that bridge microbiology, immunology, and cell biology:

  • In vitro infection models:

    • Infection of relevant cell types (macrophages, neutrophils, epithelial cells) with wildtype versus YPA_1696 mutant Y. pestis

    • Assessment of bacterial adhesion, invasion, and intracellular survival

    • Analysis of host cell responses (cytokine production, inflammatory signaling, cell death)

  • Ex vivo tissue models:

    • Infection of lymph node explants to mimic bubonic plague

    • Lung tissue models to study pneumonic plague

    • Quantification of bacterial dissemination and tissue damage

  • In vivo animal models:

    • Mouse models of bubonic, pneumonic, or septicemic plague

    • Comparison of wildtype versus YPA_1696 mutant virulence

    • In vivo imaging to track infection progression

    • Analysis of immune responses and bacterial burden in tissues

  • Omics approaches:

    • Transcriptomic analysis of host and pathogen during infection

    • Proteomics to identify host proteins interacting with YPA_1696

    • Metabolomics to assess metabolic changes during infection

  • Structural biology approaches:

    • Structural determination of YPA_1696 in complex with host receptors or proteins

    • Epitope mapping to identify regions involved in host recognition

Understanding how Y. pestis survives in host innate immune cells during early infection stages is a key research priority in the field , and investigating YPA_1696's potential contribution to this process would be valuable.

How can structural biology techniques be applied to understand the function of UPF0283 membrane proteins?

Structural biology offers powerful approaches to elucidate the function of uncharacterized membrane proteins like YPA_1696:

  • X-ray crystallography:

    • Crystallization trials with various detergents, lipids, and stabilizing agents

    • Use of antibody fragments or nanobodies to facilitate crystallization

    • Structure determination at various resolutions to identify functional domains

  • Cryo-electron microscopy (cryo-EM):

    • Single-particle analysis for higher molecular weight complexes

    • Cryo-electron tomography for visualizing the protein in native membrane environments

    • Analysis of different conformational states to understand functional dynamics

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Solution NMR for structural characterization of soluble domains

    • Solid-state NMR for studying the membrane-embedded regions

    • Dynamics measurements to identify flexible regions important for function

  • Integrative structural biology approaches:

    • Combination of low-resolution data from SAXS with computational modeling

    • Cross-linking mass spectrometry to identify spatial relationships between domains

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-accessible regions

  • Computational methods:

    • Molecular dynamics simulations in membrane environments

    • Computational ligand docking to identify potential binding partners

    • Evolutionary coupling analysis to predict functional residues

Recent advances in structural biology techniques, particularly in cryo-EM, have revolutionized membrane protein research, making previously challenging targets more accessible to structural determination.

What biosafety considerations are essential when working with recombinant proteins from Yersinia pestis?

Working with recombinant proteins derived from Y. pestis requires careful attention to biosafety protocols due to the pathogen's classification as a Tier 1 Select Agent and its historical impact as the causative agent of plague :

  • Risk assessment:

    • Evaluation of the specific recombinant protein's potential hazards

    • Determination of appropriate biosafety level (typically BSL-2 for recombinant proteins expressed in E. coli)

    • Review of institutional and regulatory requirements

  • Laboratory containment measures:

    • Use of certified biosafety cabinets for aerosol-generating procedures

    • Implementation of proper waste decontamination protocols

    • Establishment of standard operating procedures (SOPs) for handling

  • Training and documentation:

    • Thorough training of personnel on biosafety procedures

    • Maintenance of detailed experimental records

    • Regular review and updating of biosafety protocols

  • Emergency response planning:

    • Development of spill and exposure response protocols

    • Establishment of medical surveillance programs if necessary

    • Regular drills for emergency situations

What are common challenges in expressing and purifying recombinant membrane proteins from Yersinia pestis?

Membrane proteins like YPA_1696 present several technical challenges during expression and purification:

  • Expression challenges:

    • Toxicity to host cells when overexpressed

    • Improper folding leading to aggregation and inclusion body formation

    • Low yield compared to soluble proteins

    • Temperature-dependent expression patterns requiring optimization

  • Purification challenges:

    • Selection of appropriate detergents for solubilization without denaturation

    • Maintaining stability during purification steps

    • Separating the target protein from host membrane proteins

    • Preventing aggregation during concentration

  • Functional validation challenges:

    • Ensuring the purified protein retains native structure and function

    • Developing appropriate assays for functional assessment

    • Reconstituting into membrane mimetics for functional studies

Challenge TypeCommon ProblemsPotential Solutions
ExpressionLow yieldOptimize codon usage, use specialized expression strains, screen multiple constructs
ToxicityUse tightly controlled inducible promoters, lower induction temperature
Inclusion bodiesLower expression temperature, co-express chaperones
SolubilizationInefficient extractionScreen multiple detergents, optimize detergent:protein ratio
Protein instabilityAdd stabilizers (glycerol, specific lipids), use milder detergents
PurificationAggregationInclude detergent in all buffers, avoid freeze-thaw cycles
ImpuritiesImplement multi-step purification, optimize washing conditions
Functional studiesActivity lossReconstitute in nanodiscs or liposomes, add essential lipids
Assay developmentUse biophysical methods to confirm proper folding

These challenges can be addressed through systematic optimization of expression conditions, careful selection of detergents, and implementation of quality control measures throughout the purification process.

How can researchers ensure reproducibility in studies involving recombinant YPA_1696?

Ensuring reproducibility in research involving recombinant membrane proteins requires meticulous attention to experimental details and documentation:

  • Standardized protocols:

    • Detailed documentation of expression conditions (strain, vector, media, temperature, induction parameters)

    • Specification of exact buffer compositions for each purification step

    • Precise recording of detergent types, concentrations, and critical micelle concentrations

  • Quality control measures:

    • Multiple purity assessments (SDS-PAGE, size exclusion chromatography profiles)

    • Protein identity confirmation (mass spectrometry, western blotting)

    • Batch-to-batch consistency checks with defined acceptance criteria

  • Validation across methods:

    • Use of complementary techniques to verify findings

    • Independent replication by different researchers

    • Comparison of results using different expression or purification approaches

  • Data management:

    • Comprehensive laboratory notebooks with all experimental details

    • Storage of raw data alongside processed results

    • Version control for analysis procedures and scripts

  • Reporting standards:

    • Transparent disclosure of all methods in publications

    • Sharing of detailed protocols through repositories or supplementary materials

    • Deposition of sequence and structural data in public databases

Implementation of these practices ensures that research findings with recombinant YPA_1696 are robust, reproducible, and can serve as a reliable foundation for further studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.