Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YpAngola_A2532 (YpAngola_A2532)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to meet customer specifications.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
YpAngola_A2532; UPF0283 membrane protein YpAngola_A2532
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Angola)
Target Names
YpAngola_A2532
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant YpAngola_A2532 typically expressed and purified for research?

Recombinant YpAngola_A2532 is commonly expressed in E. coli expression systems using His-tag fusion constructs for simplified purification. The methodological approach involves:

  • Cloning the full-length gene (1-353 amino acids) with an N-terminal His-tag

  • Transformation into an appropriate E. coli strain

  • Induction of protein expression

  • Cell lysis and membrane fraction isolation

  • Affinity chromatography using nickel or cobalt resins

  • Elution and buffer exchange

  • Lyophilization for long-term storage

The purified protein typically yields greater than 90% purity as determined by SDS-PAGE analysis . This method allows for scalable production of the target protein while maintaining its structural integrity.

What are the recommended storage and handling procedures for recombinant YpAngola_A2532?

Optimal storage and handling of recombinant YpAngola_A2532 requires careful attention to temperature, buffer composition, and aliquoting strategies:

Storage ConditionRecommended ProtocolNotes
Long-term storage-20°C/-80°CAliquoting necessary for multiple use
Working aliquots4°CStable for up to one week
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)Brief centrifugation recommended prior to opening
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0For lyophilized powder
After reconstitutionAdd 5-50% glycerol (final concentration)Default final concentration is 50%

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. Proper aliquoting upon initial reconstitution minimizes the need for multiple freeze-thaw events .

What expression systems are most effective for producing functional YpAngola_A2532?

While E. coli remains the standard expression system for YpAngola_A2532, alternative systems may offer advantages for specific experimental aims:

Expression SystemAdvantagesLimitationsApplication Scenarios
E. coliHigh yield, cost-effective, rapid productionMay lack post-translational modificationsBasic structural studies, antibody production
Plant-based systemsCorrect folding of complex proteins, scalableLonger production timeVaccine development, structural studies
Insect cellsEnhanced post-translational processingHigher cost, complex protocolsFunctional studies requiring native conformation
Cell-free systemsAvoids toxicity issues, rapidLower yield, expensiveRapid screening, difficult-to-express variants

For functional studies of membrane proteins like YpAngola_A2532, researchers should consider incorporating approaches such as detergent screening or nanodiscs to maintain native membrane environment. The methodological choice depends on downstream applications and required protein characteristics .

How can researchers validate the proper folding and functionality of recombinant YpAngola_A2532?

Validating proper folding and functionality of recombinant YpAngola_A2532 requires a multi-technique approach:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure content

    • Size exclusion chromatography to evaluate oligomeric state

    • Limited proteolysis to probe accessible regions

  • Functional Assays:

    • Lipid binding assays if transport function is suspected

    • ATPase activity measurements if energetic coupling is present

    • Reconstitution into liposomes to assess membrane integration

  • Biophysical Characterization:

    • Thermal shift assays to determine stability

    • Surface plasmon resonance to evaluate potential binding partners

    • Isothermal titration calorimetry for thermodynamic parameters

Each technique provides complementary information, building a comprehensive profile of protein quality and functionality. Researchers should select methods aligned with the suspected biological role of YpAngola_A2532 .

What are the recommended approaches for studying membrane integration of YpAngola_A2532?

Studying membrane integration of YpAngola_A2532 requires specialized techniques that maintain the protein's native environment:

  • Computational Prediction:

    • Use TMHMM, HMMTOP, or similar algorithms to predict transmembrane domains

    • Hydropathy analysis to identify potential membrane-spanning regions

  • Experimental Validation:

    • Protease protection assays to determine topology

    • Site-directed fluorescence labeling to track insertion

    • Sucrose gradient centrifugation to confirm membrane association

  • Advanced Structural Methods:

    • Electron microscopy of reconstituted protein

    • Solid-state NMR of isotopically labeled protein

    • X-ray crystallography of stabilized protein (challenging)

The transmembrane regions predicted from the amino acid sequence (positions approximately 60-80, 90-110, 180-200, and 260-280) can guide experimental design for topology mapping studies .

How does YpAngola_A2532 contribute to Y. pestis pathogenicity and virulence mechanisms?

The role of YpAngola_A2532 in Y. pestis pathogenicity remains incompletely characterized but can be investigated through several methodological approaches:

  • Gene Knockout Studies:

    • Create deletion mutants using CRISPR-Cas9 or homologous recombination

    • Assess virulence in animal models using different infection routes

    • Measure bacterial load and dissemination patterns

  • Host-Pathogen Interaction Analysis:

    • Identify potential host binding partners using pull-down assays

    • Determine localization during infection using immunofluorescence

    • Assess impact on host cell signaling pathways

  • Comparative Genomics:

    • Analyze conservation across Y. pestis strains and biovars

    • Compare with homologs in other Yersinia species

    • Examine evolutionary patterns in relation to virulence

Understanding YpAngola_A2532's contribution to pathogenicity must consider Y. pestis' complex transmission cycle and virulence mechanisms. The bacterium's ability to transition between flea vectors and mammalian hosts involves numerous membrane proteins that may interact with YpAngola_A2532 .

What are the challenges in developing antibodies against YpAngola_A2532 for research applications?

Developing effective antibodies against membrane proteins like YpAngola_A2532 presents several methodological challenges:

  • Antigen Preparation Challenges:

    • Maintaining native conformation in detergent solutions

    • Identifying immunogenic epitopes that are accessible

    • Preventing aggregation during immunization

  • Immunization Strategies:

    • Use of adjuvants appropriate for membrane proteins

    • Prime-boost regimens to enhance specificity

    • Selection of animal species with optimal immune response

  • Validation Requirements:

    • Testing across multiple assay platforms (WB, IF, IP, ELISA)

    • Confirming specificity against related UPF0283 family proteins

    • Evaluating cross-reactivity with other Y. pestis membrane proteins

Researchers should consider developing antibodies against predicted extracellular loops or specific peptide regions rather than the full protein. Alternative approaches include using recombinant antibody technologies like phage display or yeast surface display to isolate binders to conformational epitopes .

How can structural biology techniques be applied to elucidate YpAngola_A2532 function?

Structural characterization of membrane proteins like YpAngola_A2532 requires specialized approaches:

TechniqueInformation ProvidedTechnical ConsiderationsSuccess Probability
X-ray CrystallographyHigh-resolution 3D structureRequires stable crystals, challenging for membrane proteinsLow-Medium
Cryo-Electron MicroscopyMedium to high-resolution 3D structureWorks well for larger complexesMedium
NMR SpectroscopyDynamic information, flexible regionsSize limitations, requires isotope labelingMedium for fragments
Hydrogen-Deuterium Exchange MSConformational dynamics, binding interfacesCompatible with detergents and lipidsHigh
Molecular Dynamics SimulationsDynamic behavior in membranesRequires initial structural modelMedium

A combined approach utilizing computational modeling with experimental validation offers the most promising strategy. Initial homology models based on related UPF0283 family proteins can guide site-directed mutagenesis to probe function. The resulting data can iteratively improve structural models and functional hypotheses .

How does YpAngola_A2532 compare to other Y. pestis membrane proteins in structure and function?

YpAngola_A2532 belongs to a broader context of Y. pestis membrane proteins that contribute to the bacterium's physiology and pathogenicity:

Membrane ProteinFunctionStructural FeaturesRelationship to YpAngola_A2532
F1 capsular antigenAnti-phagocytic activityForms external capsuleDifferent localization and function
V antigen (LcrV)Type III secretion system componentSecreted proteinDifferent localization and function
YadCAdhesinOuter membrane proteinShares membrane localization but different function
PsaApH 6 antigen, fimbrial structureSurface-exposedDifferent membrane association pattern
YpAngola_A2532Unknown (potential transport or signaling)Multiple transmembrane domainsFocus of current analysis

Unlike well-characterized virulence factors such as F1 and V antigens, which have been developed as vaccine candidates, YpAngola_A2532's role remains largely undetermined. Its conservation across Y. pestis strains suggests functional importance, potentially in basic cellular processes rather than direct host interaction .

What experimental approaches can distinguish the functional roles of YpAngola_A2532 in different Y. pestis biovars?

Y. pestis biovar differentiation has significant implications for pathogenicity and evolution. To investigate YpAngola_A2532's role across biovars:

  • Comparative Genomics Approach:

    • Sequence alignment across Antiqua, Medievalis, and Orientalis biovars

    • Identification of single nucleotide polymorphisms or structural variations

    • Analysis of selection pressure on different protein domains

  • Functional Complementation Studies:

    • Create knockout mutants in multiple biovars

    • Cross-complementation with YpAngola_A2532 from different biovars

    • Phenotypic characterization including growth rates and stress responses

  • Biovar-Specific Interaction Analysis:

    • Yeast two-hybrid or pull-down assays to identify biovar-specific binding partners

    • Comparative phosphoproteomics to assess signaling differences

    • Localization studies under biovar-specific growth conditions

The three biovars of Y. pestis (Antiqua, Medievalis, and Orientalis) differ in their ability to reduce nitrate and utilize glycerol. Antiqua biovars like the Angola strain are positive for both capabilities, which may influence the functional context of YpAngola_A2532 .

How might YpAngola_A2532 be utilized in developing diagnostic tools for Y. pestis detection?

Leveraging YpAngola_A2532 for diagnostic applications requires understanding its specificity and immunogenicity:

  • Antigen-Based Detection Methods:

    • ELISA development using recombinant YpAngola_A2532

    • Lateral flow immunoassays for field detection

    • Antibody arrays for multiplexed detection

  • Nucleic Acid-Based Approaches:

    • PCR primers targeting YpAngola_A2532 gene sequences

    • LAMP assays for field-deployable detection

    • Next-generation sequencing panels including YpAngola_A2532

  • Evaluation Parameters:

    • Sensitivity and specificity determination against related Yersinia species

    • Cross-reactivity assessment with environmental samples

    • Stability testing under field conditions

The development of rapid, reliable diagnostics is crucial given Y. pestis's classification as a potential bioterrorism agent requiring BSL-3 containment for research. Diagnostic approaches should be validated against the diverse strains circulating in endemic regions of Africa, Asia, and the Americas .

What are the potential applications of YpAngola_A2532 in vaccine development strategies?

While F1 and V antigens remain the primary focus of Y. pestis vaccine development, YpAngola_A2532 presents alternative or complementary approaches:

  • Epitope Mapping and Vaccine Design:

    • Identification of surface-exposed, immunogenic regions

    • B-cell and T-cell epitope prediction and validation

    • Design of multi-epitope constructs incorporating YpAngola_A2532 segments

  • Expression Platform Considerations:

    • Plant-based expression systems for cost-effective production

    • Bacterial vectors for mucosal delivery

    • mRNA-based approaches for rapid development

  • Adjuvant and Formulation Strategies:

    • Selection of adjuvants promoting appropriate immune responses

    • Lipid nanoparticle formulations for membrane protein delivery

    • Combination with established F1-V subunit vaccines

Recombinant subunit vaccines based on Y. pestis antigens have shown promise in animal models, with plant-derived antigens demonstrating protective efficacy against aerosol challenge. YpAngola_A2532 could potentially enhance these approaches, particularly if it proves to be conserved across strains and exposing immunogenic epitopes during infection .

What methodological approaches can address the challenges of expressing and studying membrane proteins like YpAngola_A2532?

Membrane proteins present unique challenges requiring specialized methodologies:

  • Expression Optimization Strategies:

    • Systematic testing of fusion partners (MBP, SUMO, Trx)

    • Codon optimization for expression host

    • Induction condition screening (temperature, inducer concentration)

    • Membrane-targeted expression systems

  • Solubilization and Stabilization Methods:

    • Detergent screening panel (non-ionic, zwitterionic, mixed micelles)

    • Nanodiscs and lipid cubic phase technologies

    • Polymer-based systems (amphipols, SMALPs)

    • Stabilizing mutations based on computational prediction

  • Functional Characterization Approaches:

    • Reconstitution into liposomes of varying composition

    • Solid-supported membrane electrophysiology

    • Single-molecule techniques to assess conformational changes

    • In silico molecular dynamics simulations in membrane environments

Overcoming these challenges requires an integrated approach combining computational prediction, high-throughput screening, and iterative optimization. Success with YpAngola_A2532 would provide valuable methodological insights applicable to other challenging membrane proteins .

How might systems biology approaches enhance our understanding of YpAngola_A2532's role in Y. pestis physiology?

Systems biology offers comprehensive frameworks to contextualize YpAngola_A2532's function:

  • Multi-omics Integration:

    • Transcriptomics to identify co-regulated genes

    • Proteomics to map protein-protein interactions

    • Metabolomics to detect functional metabolic impacts

    • Integration of datasets to build predictive models

  • Network Analysis Approaches:

    • Protein interaction networks based on pull-down experiments

    • Genetic interaction mapping using CRISPR interference

    • Pathway analysis incorporating known membrane protein functions

    • Evolutionary analysis of gene neighborhoods

  • Phenotypic Profiling Methods:

    • High-content imaging of bacterial populations

    • Growth curve analysis under various stressors

    • Transposon sequencing to map genetic interactions

    • Microfluidic single-cell analysis of bacterial behavior

These approaches would place YpAngola_A2532 within the broader context of Y. pestis biology, potentially revealing unexpected functions and interactions. Understanding the protein's role in different ecological niches (flea vector versus mammalian host) would be particularly valuable for comprehensive modeling of plague transmission dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.