Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YPN_1807 (YPN_1807)

Shipped with Ice Packs
In Stock

Description

Introduction

Yersinia pestis, a Gram-negative bacterium, is the causative agent of plague, a highly virulent disease affecting humans and other mammals . The bacterium employs a type III secretion system (T3SS) to inject virulence factors, known as Yersinia outer proteins (Yops), into host cells, thereby subverting the host's immune responses . Among the numerous proteins produced by Y. pestis, the Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YPN_1807 (YPN_1807) is a protein of interest .

General Information

Recombinant Yersinia pestis bv. Antiqua UPF0283 membrane protein YPN_1807 (YPN_1807) is a partial protein with a molecular weight of approximately 39,264 Da and a purity level exceeding 85% as determined by SDS-PAGE . It is also identified as TIGR01620 family protein and UPF0283 membrane protein YPN_1807 . The gene ID is YPN_1807, and its accession number is WP_002210980.1 .

Protein Structure

Proteins possess four levels of structural organization: primary, secondary, tertiary, and quaternary .

Yops and Virulence

  • Yersinia outer proteins (Yops) are crucial virulence factors that modulate host cell functions . These proteins are encoded on a 75-kb plasmid, and their expression, secretion, and translocation are regulated by temperature, calcium, and contact with eukaryotic cells . Some Yops functions include:

    • YopE: Causes a cytotoxic effect on the host cell, leading to the depolymerization of actin microfilaments .

    • YopH: Dephosphorylates host cell proteins .

    • YpkA: Exhibits serine/threonine kinase activity .

    • YopB/D and YopN: Involved in translocation and act as sensor functions .

    • YopM: Inhibits platelet aggregation .

    • YopK: Controls Yop translocation and contributes to establishing systemic infection .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped on standard blue ice packs. Dry ice shipping is available upon request, but will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.

Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Note: The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
YPN_1807; YP516_2007; UPF0283 membrane protein YPN_1807
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
YPN_1807
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links

KEGG: ypn:YPN_1807

Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pestis bv. Antiqua and how does it relate to other Y. pestis strains?

Yersinia pestis biovar (bv.) Antiqua represents one of the classical biovars of Y. pestis, with the Nepal516 strain being a key representative. This biovar is distinguished from other biovars (Medievalis and Orientalis) based on biochemical properties and geographical distribution. The Antiqua biovar is believed to be associated with the first pandemic of plague and is typically found in Central Africa and Central Asia. Researchers should note that comparative genomic analysis between biovars can provide insights into the evolution of virulence and host adaptation mechanisms .

When studying this biovar, it's essential to implement appropriate biosafety procedures as Y. pestis is classified as a Tier 1 select agent requiring BSL-3 containment facilities. Molecular characterization should include PCR verification of strain-specific markers and whole genome sequencing to confirm the specific strain identity before proceeding with protein expression studies.

What is the UPF0283 protein family and what functional significance does it have?

The UPF0283 protein family belongs to uncharacterized protein families with predicted membrane localization. The "UPF" designation indicates that these proteins have an "Uncharacterized Protein Family" status in UniProt classification. Based on sequence analysis, YPN_1807 is predicted to be a membrane protein with potential roles in membrane integrity, transport, or signaling .

The methodological approach to studying such uncharacterized proteins typically involves:

  • Bioinformatic analysis of conserved domains

  • Homology modeling to predict structure

  • Gene knockout studies to evaluate phenotypic changes

  • Protein-protein interaction studies to identify binding partners

  • Localization studies using fluorescent tagging

Researchers should begin with comparative sequence analysis across multiple bacterial species to identify conserved regions that might indicate functional significance before proceeding to experimental characterization.

What expression systems are recommended for recombinant production of YPN_1807?

For membrane proteins like YPN_1807, expression system selection is critical due to challenges in proper folding and insertion into membranes. Based on general principles for membrane protein expression, the following methodological approaches are recommended:

Expression SystemAdvantagesChallengesOptimization Strategies
E. coliRapid growth, high yieldPotential inclusion body formation, improper foldingUse C41/C43 strains, optimize induction temperature (16-20°C), include mild detergents
Insect cellsBetter for complex membrane proteins, proper foldingLonger production time, higher costOptimize MOI, harvest timing, use Sf9 or High Five cells
Mammalian cellsNative-like membrane environmentLowest yield, highest costUse inducible expression systems, optimize transfection conditions

When working with YPN_1807, researchers should consider starting with E. coli expression using specialized strains designed for membrane protein expression (such as Lemo21, C41/C43). Expression should be conducted at lower temperatures (16-20°C) with mild induction conditions to promote proper folding and membrane insertion .

How can researchers investigate the potential role of YPN_1807 in Y. pestis virulence?

To investigate the potential role of YPN_1807 in virulence, researchers should implement a multi-faceted approach:

  • Gene knockout and complementation studies:

    • Generate a clean deletion mutant (ΔYPN_1807) using allelic exchange techniques

    • Complement with an inducible expression system

    • Assess virulence phenotypes in cellular and animal models

  • Transcriptomic profiling:

    • Compare gene expression patterns between wild-type and ΔYPN_1807 strains

    • Focus on known virulence factors expression changes

    • Analyze under conditions that mimic host environments (temperature shift, nutrient limitation)

  • Protein interaction studies:

    • Use pull-down assays with tagged YPN_1807

    • Perform bacterial two-hybrid screening

    • Validate interactions using co-immunoprecipitation

    • Identify host proteins that interact with YPN_1807

  • Host response assessment:

    • Measure cytokine production in infected macrophages

    • Assess bacterial survival in phagocytes

    • Evaluate impact on neutrophil extracellular trap (NET) formation

These methodological approaches should be performed under appropriate biosafety conditions, and researchers should consider using attenuated strains for initial characterization before moving to fully virulent strains .

What structural biology techniques are most appropriate for determining the three-dimensional structure of YPN_1807?

Determining the 3D structure of membrane proteins presents unique challenges due to their hydrophobic nature and requirement for a lipid environment. For YPN_1807, researchers should consider a combination of the following techniques:

TechniqueResolutionAdvantagesLimitationsSample Requirements
X-ray CrystallographyUp to 1.5 ÅHighest resolutionDifficult crystallization5-10 mg purified protein, stable crystals
Cryo-EM2-4 ÅNo crystallization neededLower resolution for small proteins3-5 mg protein, homogeneous sample
NMR SpectroscopyVariableDynamic informationSize limitationsIsotope-labeled protein (15N, 13C)
AlphaFold2 PredictionVariableNo experimental sample neededValidation requiredSequence only

For YPN_1807, a methodological workflow might include:

  • Initial structure prediction using AlphaFold2

  • Purification in lipid nanodiscs or amphipols

  • Screening for crystallization conditions in lipidic cubic phase

  • X-ray diffraction data collection at synchrotron facilities

  • Structure solution and refinement

Researchers should validate computational predictions with experimental data such as cross-linking mass spectrometry or hydrogen-deuterium exchange to confirm structural elements .

How can researchers assess the interaction of YPN_1807 with the host immune system?

To investigate potential interactions between YPN_1807 and host immune components, researchers should implement the following methodological approaches:

  • Recombinant protein-based assays:

    • ELISA-based binding assays with purified immune receptors

    • Surface plasmon resonance to determine binding kinetics

    • Flow cytometry to assess binding to immune cells

  • Cell-based functional assays:

    • Measure NF-κB activation in reporter cell lines

    • Assess impact on pattern recognition receptor signaling

    • Evaluate effect on phagosome maturation

  • Ex vivo infection models:

    • Compare wild-type and ΔYPN_1807 bacteria in:

      • Human macrophage infection models

      • Neutrophil killing assays

      • Whole blood survival assays

  • Comparative immunoproteomics:

    • Identify changes in host cell proteome upon exposure to YPN_1807

    • Map post-translational modifications induced by bacterial infection

    • Compare results between wild-type and mutant strains

This systematic approach should help determine whether YPN_1807 functions as an immunomodulatory protein similar to other Yersinia outer membrane proteins that are known to subvert host immune responses .

What are the optimal conditions for purifying recombinant YPN_1807?

Purification of membrane proteins requires careful optimization to maintain native structure and function. For YPN_1807, researchers should consider this methodological workflow:

  • Membrane isolation and solubilization:

    • Harvest cells and disrupt by sonication or French press

    • Isolate membrane fraction by ultracentrifugation

    • Screen detergent panel for optimal solubilization:

DetergentConcentrationSolubilization EfficiencyProtein Stability
DDM1-2%HighModerate
LMNG0.5-1%ModerateHigh
Digitonin1-2%ModerateHigh
Triton X-1001%HighLow
  • Affinity chromatography:

    • Use immobilized metal affinity chromatography (IMAC) with His-tag

    • Include 5-10% glycerol and 0.5 CMC detergent in all buffers

    • Consider on-column detergent exchange to more stable detergents

  • Size exclusion chromatography:

    • Use as final polishing step

    • Monitor monodispersity and oligomeric state

    • Evaluate protein stability over time in different buffer conditions

  • Quality control:

    • SDS-PAGE and western blotting

    • Circular dichroism to confirm secondary structure

    • Thermal shift assays to optimize buffer conditions

This approach should yield purified YPN_1807 suitable for structural and functional studies. Researchers should verify protein identity using mass spectrometry and N-terminal sequencing .

How can researchers develop reliable antibodies against YPN_1807 for detection and functional studies?

Development of specific antibodies against membrane proteins presents challenges due to their hydrophobic nature and limited exposed epitopes. For YPN_1807, researchers should consider the following methodology:

  • Epitope selection:

    • Perform bioinformatic analysis to identify:

      • Surface-exposed regions based on topology predictions

      • Regions with high antigenicity and hydrophilicity

      • Sequences unique to YPN_1807 (to avoid cross-reactivity)

  • Immunization strategies:

    • Synthesize KLH-conjugated peptides from predicted epitopes

    • Express and purify soluble domains for immunization

    • Consider DNA immunization encoding full-length protein

  • Antibody validation:

    • Test against recombinant protein by western blot

    • Verify specificity against Y. pestis lysates

    • Confirm lack of cross-reactivity with other Yersinia species

    • Validate for immunofluorescence applications

  • Monoclonal antibody development:

    • Screen hybridoma clones against different epitopes

    • Select clones that recognize native protein

    • Characterize epitope specificity using peptide arrays

This systematic approach should yield antibodies suitable for detection, localization, and functional studies of YPN_1807 in both recombinant systems and native bacterial contexts .

What are the appropriate cell-based assays to evaluate YPN_1807 function?

To assess the functional role of YPN_1807 in cellular contexts, researchers should implement the following methodological approaches:

  • Bacterial survival assays:

    • Compare wild-type and ΔYPN_1807 mutant survival in:

      • Human macrophage cell lines (THP-1, U937)

      • Primary human neutrophils

      • Murine bone marrow-derived macrophages

    • Quantify bacterial load at different time points post-infection

  • Membrane integrity assessment:

    • Evaluate membrane potential using fluorescent dyes

    • Measure susceptibility to membrane-active antimicrobials

    • Assess outer membrane permeability using hydrophobic probes

  • Protein localization studies:

    • Generate fluorescently tagged YPN_1807

    • Perform immunofluorescence microscopy

    • Conduct subcellular fractionation to confirm membrane association

  • Host-pathogen interaction assays:

    • Measure cytokine production in infected cells

    • Assess activation of innate immune signaling pathways

    • Evaluate impact on phagosome-lysosome fusion

When designing these experiments, researchers should include appropriate controls including complemented mutant strains and inactive protein variants to ensure specificity of observed phenotypes .

How does YPN_1807 compare to similar proteins in other bacterial pathogens?

Comparative analysis of YPN_1807 with homologs in other bacteria can provide insights into its evolutionary conservation and functional significance. Researchers should implement the following methodological approach:

  • Sequence-based comparison:

    • Perform BLAST and HMM searches to identify homologs

    • Conduct multiple sequence alignment to identify conserved residues

    • Construct phylogenetic trees to understand evolutionary relationships

OrganismProtein IDSequence Identity (%)Predicted Function
Y. pseudotuberculosisYPK_201198.3UPF0283 family protein
Y. enterocoliticaYE257592.1Membrane protein
E. coliYfcA65.7Inner membrane protein
Salmonella entericaSTM290364.2Putative membrane protein
Shigella flexneriSF276665.5Hypothetical protein
  • Structural comparison:

    • Generate homology models for identified homologs

    • Align 3D structures to identify conserved structural elements

    • Map conservation onto structural models to identify functional sites

  • Genomic context analysis:

    • Compare operonic organization across species

    • Identify co-conserved genes that might function together

    • Analyze regulatory elements in promoter regions

  • Functional complementation:

    • Express homologs in ΔYPN_1807 Y. pestis

    • Assess restoration of phenotypes

    • Identify functionally important domains through chimeric proteins

This comparative approach can help determine whether YPN_1807 serves a pathogen-specific function or plays a more general role in bacterial physiology .

How does YPN_1807 contribute to the membrane biology of Y. pestis compared to other membrane proteins?

Understanding the role of YPN_1807 in the context of Y. pestis membrane biology requires comparison with other membrane-associated proteins. Researchers should implement this methodological framework:

  • Membrane proteome analysis:

    • Perform quantitative proteomics of membrane fractions

    • Compare expression levels under different growth conditions

    • Identify proteins co-regulated with YPN_1807

  • Protein-protein interaction network:

    • Conduct pull-down experiments with tagged YPN_1807

    • Perform crosslinking mass spectrometry to identify neighbors

    • Map interactions with other membrane components

  • Functional categorization:

    • Compare phenotypes of different membrane protein mutants

    • Assess contribution to membrane integrity

    • Evaluate role in stress response and adaptation

  • Structural organization:

    • Perform freeze-fracture electron microscopy

    • Use super-resolution microscopy to visualize protein clusters

    • Identify potential membrane microdomains

This systematic comparison will help position YPN_1807 within the broader context of Y. pestis membrane biology and may reveal functional connections with known virulence factors like the Yersinia outer membrane proteins (Yops) that are critical for pathogenesis .

What are the considerations for developing YPN_1807 as a potential diagnostic marker for Y. pestis infection?

YPN_1807 could potentially serve as a diagnostic marker for Y. pestis detection. Researchers interested in this application should consider the following methodological approach:

  • Specificity assessment:

    • Evaluate sequence conservation across Y. pestis strains

    • Test for cross-reactivity with closely related Yersinia species

    • Assess potential cross-reactivity with human proteins

  • Assay development:

    • Design specific primers for PCR-based detection

    • Develop antibody-based detection methods (ELISA, lateral flow)

    • Explore aptamer selection against YPN_1807

  • Clinical validation:

    • Test with diverse clinical specimens

    • Determine sensitivity and specificity metrics

    • Compare with established diagnostic methods

  • Point-of-care adaptation:

    • Optimize for field-deployable formats

    • Assess stability under various storage conditions

    • Evaluate ease of use in resource-limited settings

Researchers should note that diagnostic development requires extensive validation, and correlation with virulence is essential when considering membrane proteins as potential biomarkers for plague diagnosis .

How can structural information about YPN_1807 be leveraged for rational drug design?

If YPN_1807 proves to be essential for Y. pestis virulence or survival, it could represent a target for antimicrobial development. Researchers should consider this methodological framework:

  • Structure-based drug design:

    • Identify potential ligand-binding pockets in the structure

    • Perform virtual screening against these pockets

    • Conduct molecular dynamics simulations to understand flexibility

  • Fragment-based screening:

    • Screen small molecule libraries against purified protein

    • Use techniques such as STD-NMR, thermal shift assays

    • Develop fragment hits into lead compounds

  • Binding assay development:

    • Establish reliable binding assays for hit validation

    • Develop functional assays to confirm mechanism of action

    • Assess structure-activity relationships of promising compounds

  • Resistance profiling:

    • Evaluate potential for resistance development

    • Identify mutations that might confer resistance

    • Design combination approaches if necessary

This structure-guided approach can potentially yield novel antimicrobials targeting Y. pestis membranes, which would represent an important addition to the therapeutic arsenal against plague .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.