Recombinant Yersinia pestis bv. Antiqua UPF0442 protein YPA_4078 (YPA_4078)

What is YPA_4078 and what role does it play in Yersinia pestis?

YPA_4078 is classified as a UPF0442 protein found in Yersinia pestis biovar Antiqua. Based on its amino acid sequence, it appears to be a membrane-associated protein with multiple transmembrane domains, as evidenced by the hydrophobic amino acid stretches in its sequence: MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV .

Methodologically, determining the precise function of YPA_4078 would require multiple approaches, including gene knockout studies, interactome analysis, and comparative expression studies between different growth conditions that mimic the flea vector (26°C) and mammalian host (37°C) environments.

What is known about the structural characteristics of YPA_4078?

The full-length YPA_4078 protein consists of 153 amino acids with several key structural features that can be inferred from its sequence :

• Multiple hydrophobic regions consistent with transmembrane domains

• Charged residues distributed between these hydrophobic segments

• A C-terminal region containing a positively charged cluster (WLYRKRPGV), suggesting a potential cytoplasmic domain

Without crystallographic or NMR data specifically for YPA_4078, structural predictions would rely on computational modeling approaches. These could include homology modeling based on related proteins, molecular dynamics simulations, and protein design algorithms similar to those described in parallel protein engineering studies .

For accurate structural characterization, researchers would need to:

• Express and purify the recombinant protein in a membrane-mimetic environment

• Apply techniques such as circular dichroism to assess secondary structure content

• Consider cryo-electron microscopy for visualization of the protein in a near-native state

• Use computational prediction tools that specifically address membrane protein topology

How is YPA_4078 expression regulated during Y. pestis infection cycles?

Y. pestis undergoes complex regulatory changes during transition between flea vectors and mammalian hosts, with temperature being a critical environmental signal . While specific expression data for YPA_4078 is not provided in the available literature, research on Y. pestis gene regulation provides a framework for understanding how this protein might be regulated.

Temperature-dependent gene regulation is essential for Y. pestis pathogenesis, with distinct transcriptional programs activated at 26°C (flea temperature) versus 37°C (mammalian host temperature) . For membrane proteins like YPA_4078, expression may be coordinated with other factors involved in adapting the cell envelope to different host environments.

To methodically investigate YPA_4078 expression:

• Perform quantitative RT-PCR across different growth conditions mimicking various stages of infection

• Develop antibodies against YPA_4078 for western blot analysis of protein levels

• Create reporter gene fusions to monitor expression in real-time during host transitions

• Apply RNA-seq to analyze transcriptional changes in context of the entire genome

• Examine potential regulatory elements in the promoter region of YPA_4078

What are the optimal conditions for working with recombinant YPA_4078 protein?

Based on product information, the optimal handling conditions for recombinant YPA_4078 include :

When designing experiments with this protein, researchers should consider:

• Buffer compatibility: The native Tris-based storage buffer should be evaluated for compatibility with downstream applications and adjusted if necessary.

• Detergent considerations: For membrane proteins, addition of mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS) may be necessary to maintain solubility while preserving native structure.

• Tag influence: The specific tag used in the recombinant protein (determined during production process) may affect protein behavior and should be accounted for in experimental design and interpretation.

• Quality control: SDS-PAGE analysis before experiments is recommended to confirm protein integrity and purity.

How can computational protein design approaches be applied to study YPA_4078?

Computational protein design approaches offer powerful methods for studying proteins like YPA_4078, especially when experimental data is limited. Based on methodologies described in parallel screening studies, researchers could apply the following approaches :

• Ensemble-based modeling: Generate multiple backbone conformations using molecular dynamics (MD) simulations or constraint-based modeling (CONCOORD) to account for protein flexibility in different membrane environments .

• Fixed backbone design: Apply tools like Rosetta to predict optimal amino acid sequences for specific backbone conformations that might enhance stability or binding to potential interaction partners .

• Molecular dynamics simulations: These can reveal conformational changes under different conditions, such as temperature shifts that Y. pestis experiences during host transition.

• Structure prediction refinement: For membrane proteins like YPA_4078, specialized algorithms that account for the membrane environment can improve structural predictions.

• Binding interface prediction: Computational docking can identify potential interaction partners and binding interfaces that might be critical for YPA_4078 function.

A systematic computational workflow would include:

• Initial homology modeling based on related proteins

• Refinement using membrane-specific force fields

• Validation through energy minimization and stability assessment

• Virtual mutagenesis to identify critical functional residues

• Docking with potential interacting partners

What experimental challenges are associated with studying membrane proteins like YPA_4078?

Membrane proteins present unique experimental challenges compared to soluble proteins. For YPA_4078 research, these challenges include:

• Expression and purification difficulties:

  • Membrane proteins often express poorly and can be toxic to expression hosts

  • Optimization strategies include using specialized vectors, lower induction temperatures, and membrane-protein-friendly host strains

  • Fusion tags (such as MBP or SUMO) may improve solubility and expression

• Maintaining native conformation:

  • Detergents used for solubilization may disrupt protein structure

  • Solution: Screen multiple detergents or utilize lipid nanodiscs, amphipols, or other membrane mimetics

  • Circular dichroism spectroscopy can help verify secondary structure preservation

• Structural determination methods:

  • X-ray crystallography: Challenging due to difficulties in forming well-ordered crystals

  • Cryo-EM: Increasingly viable for membrane proteins, though size limitations apply

  • NMR: Suitable for dynamic studies but typically limited to smaller membrane proteins

  • Computational prediction: Becoming more reliable with advances in AI-based tools

• Functional characterization approaches:

  • Reconstitution in liposomes for transport or channel studies

  • Fluorescence-based assays for conformational changes

  • Surface plasmon resonance for interaction studies (requires detergent compatibility)

How does YPA_4078 compare across different Y. pestis biovars?

Y. pestis is classified into five biovars (Antiqua, Mediaevalis, Orientalis, Microtus, and Intermedium) based on biochemical differences including glycerol fermentation, arabinose utilization, and nitrate reduction . Comparing YPA_4078 across these biovars could provide valuable insights into protein function and evolution.

Table 1: Comparative Analysis Framework for YPA_4078 Across Y. pestis Biovars

Methodological approaches for comparative analysis should include:

• Sequence alignment across biovars to identify conserved and variable regions

• Structural modeling to predict how variations might affect protein folding or interactions

• Expression analysis under identical conditions to identify regulatory differences

• Functional complementation studies to test interchangeability between biovar variants

These comparative studies could reveal whether YPA_4078 contributes to the phenotypic differences between biovars, particularly the differential virulence observed between highly pathogenic biovars and the less virulent Microtus biovar .

How can protein engineering approaches be used to investigate YPA_4078 function?

Protein engineering approaches similar to those described for other protein systems can be applied to investigate YPA_4078 function . A comprehensive strategy would include:

• Computational design of variant libraries:

  • Using methods like molecular dynamics (MD), CONCOORD, and Backrub to generate ensembles of protein backbones

  • Applying Rosetta fixed backbone design to identify optimal sequences for specific interactions

  • Creating focused libraries targeting predicted functional domains

• High-throughput screening systems:

  • Phage display adapting techniques used for other proteins

  • Yeast two-hybrid (Y2H) systems modified for membrane proteins

  • Bacterial two-hybrid systems specifically designed for membrane protein interactions

  • Custom oligonucleotide arrays for parallel synthesis of designed variants

• Binding characterization and validation:

  • Surface plasmon resonance (SPR) for kinetic analysis of binding

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Microscale thermophoresis for interactions in complex solutions

  • Cross-linking mass spectrometry to identify interaction interfaces

A methodical workflow would involve:

• Initial computational design of 1,000-10,000 variants based on different modeling approaches

• Synthesis of variant libraries using custom oligonucleotide arrays

• Primary screening using display technologies adapted for membrane proteins

• Secondary validation of promising candidates with biophysical methods

• Functional characterization in cellular contexts

What insights might systematic mutation studies of YPA_4078 provide about Y. pestis adaptation?

Y. pestis undergoes significant adaptations when transitioning between flea vectors and mammalian hosts, involving temperature-sensing mechanisms and expression changes . Systematic mutation studies of YPA_4078 could reveal:

• Temperature-dependent functional changes:

  • Alanine scanning mutagenesis to identify residues critical at 26°C versus 37°C

  • Analysis of mutant effects on membrane localization at different temperatures

  • Identification of regions involved in temperature-dependent protein-protein interactions

• Host-specific adaptations:

  • Mutations affecting interactions with host proteins or cellular structures

  • Changes in protein function under different host environmental conditions (pH, ion concentrations)

  • Residues involved in sensing or responding to host-specific signals

• Contribution to pathogenesis:

  • Correlation between specific mutations and bacterial survival in macrophages

  • Effects on bacterial growth in blood, which is essential for the Y. pestis lifecycle

  • Impact on transmission efficiency between hosts

• Evolutionary analysis:

  • Comparison with ancestral sequences reconstructed from Y. pseudotuberculosis

  • Identification of positively selected residues during evolution to flea-mammal transmission

Methodologically, this would require:

• Precise genetic manipulation techniques for Y. pestis

• In vitro and in vivo infection models representing different stages of the bacterial lifecycle

• Comprehensive phenotypic characterization of mutants

• Integration of results with systems biology approaches to understand network effects

How might research on YPA_4078 contribute to understanding Y. pestis pathogenesis?

Research on YPA_4078 could contribute significantly to our understanding of Y. pestis biology and pathogenesis in several ways:

• Temperature adaptation mechanisms:

  • YPA_4078, as a membrane protein, might play a role in sensing or responding to temperature shifts during host transition

  • Its characterization could reveal novel aspects of how Y. pestis adapts its membrane composition and function between the flea vector and mammalian host

• Host-pathogen interactions:

  • If YPA_4078 interfaces with host cells, it could be involved in critical processes like adhesion, invasion, or immune evasion

  • Understanding these interactions could reveal new aspects of Y. pestis virulence mechanisms

• Biovar-specific adaptations:

  • Variations in YPA_4078 across biovars might contribute to their differential virulence and host range

  • This could provide insights into the evolution of plague pathogenesis

• Metabolic adaptations:

  • As Y. pestis shows specific metabolic adaptations including constitutive expression of the glyoxylate bypass pathway , YPA_4078 might be involved in membrane-associated metabolic functions

  • This could enhance our understanding of how Y. pestis survives in different host environments

• Potential therapeutic applications:

  • If YPA_4078 proves essential for pathogenesis or survival, it could represent a novel drug target

  • Structure-based drug design approaches could be applied to develop inhibitors

A comprehensive research program would integrate multiple methodologies including genetic, biochemical, structural, and computational approaches to fully characterize this protein's role in Y. pestis biology.

What emerging technologies might accelerate research on proteins like YPA_4078?

Several emerging technologies show promise for advancing research on uncharacterized membrane proteins like YPA_4078:

• AI-driven protein structure prediction:

  • Tools like AlphaFold and RoseTTAFold are revolutionizing protein structure prediction

  • These could provide accurate structural models of YPA_4078 without crystallization

  • Specialized versions optimized for membrane proteins are being developed

• Single-molecule techniques:

  • Advanced microscopy methods allowing visualization of individual protein dynamics in membranes

  • Single-molecule FRET to study conformational changes in response to environmental conditions

  • These techniques can reveal heterogeneity masked in ensemble measurements

• Advanced mass spectrometry:

  • Native mass spectrometry for membrane protein complexes

  • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

  • Crosslinking mass spectrometry for protein interaction mapping

  • These methods provide structural information complementary to crystallography and cryo-EM

• High-throughput combinatorial approaches:

  • Massively parallel protein engineering utilizing computational design

  • Deep mutational scanning to comprehensively map sequence-function relationships

  • These approaches can systematically explore sequence space to identify critical functional residues

• Integrated computational-experimental pipelines:

  • Combining computational design with high-throughput screening

  • Machine learning models trained on experimental data to improve prediction accuracy

  • These integrated approaches leverage strengths of both computational and experimental methods

How can researchers effectively integrate structural biology and functional genomics for YPA_4078 studies?

An effective integration of structural biology and functional genomics approaches would provide comprehensive insights into YPA_4078 function:

• Structure-guided functional genomics:

  • Use computational structural predictions to guide targeted mutagenesis

  • Design mutations specifically targeting predicted functional domains or interfaces

  • Apply CRISPR-based genome editing for precise chromosomal modifications in Y. pestis

• Multi-scale structural analysis:

  • Combine high-resolution structural techniques (X-ray, cryo-EM) with lower-resolution methods (SAXS, FRET)

  • Integrate dynamic information from molecular dynamics simulations

  • Correlate structural features with expression patterns across different growth conditions

• Interactome mapping:

  • Apply proximity labeling techniques (BioID, APEX) adapted for membrane proteins

  • Identify interaction partners under different conditions mimicking host environments

  • Validate key interactions with structural studies of protein complexes

• Systems biology integration:

  • Correlate YPA_4078 structural changes with global transcriptomic and proteomic responses

  • Model the protein's role within membrane-associated protein networks

  • Connect molecular function to cellular phenotypes using computational models

• Evolutionary structure-function analysis:

  • Compare sequence conservation patterns across Y. pestis biovars in context of structural domains

  • Identify co-evolving residues that might indicate functional interactions

  • Relate structural features to the evolutionary history of Y. pestis from Y. pseudotuberculosis

This integrated approach would build a comprehensive understanding of YPA_4078 from molecular mechanisms to its role in the complex biology and pathogenesis of Y. pestis.