Recombinant Yersinia pestis bv. Antiqua UPF0442 protein YPN_0358 (YPN_0358)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
YPN_0358; UPF0442 protein YPN_0358
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-153
Protein Length
full length protein
Species
Yersinia pestis bv. Antiqua (strain Nepal516)
Target Names
YPN_0358
Target Protein Sequence
MGVSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIEL ASLVASIMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEALMST MVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Uniprot No.

Target Background

Database Links

KEGG: ypn:YPN_0358

Protein Families
UPF0442 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the biological context of Yersinia pestis biovar Antiqua?

Yersinia pestis is the causative agent of plague, with distinct biovars (Antiqua, Medievalis, and Orientalis) associated with different pandemics throughout history. The Antiqua biovar is believed to be associated with one of the major historical pandemics . Y. pestis evolved relatively recently from Y. pseudotuberculosis (approximately 1,500-20,000 years ago), transitioning from an enteric pathogen to a vector-borne disease .

BiovarAssociated PandemicCharacteristics
AntiquaFirst pandemicFound primarily in Africa and Central Asia
MedievalisSecond pandemic (Black Death)Associated with Medieval plague
OrientalisModern/third pandemicCurrently circulating strain

Understanding proteins like YPN_0358 may provide insights into the pathogenicity and evolution of this significant human pathogen .

How can researchers obtain and verify recombinant YPN_0358 protein?

When working with recombinant YPN_0358, researchers should:

  • Verify protein identity through Western blot using anti-His antibodies (for His-tagged versions) or specific antibodies against YPN_0358

  • Confirm protein integrity through SDS-PAGE to check molecular weight (~17 kDa plus tag size)

  • Validate purity through analytical techniques such as size-exclusion chromatography

  • Consider sequence verification through mass spectrometry or N-terminal sequencing

Recombinant YPN_0358 is typically produced in E. coli expression systems with a His-tag for purification purposes . Storage recommendations include keeping the protein in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term storage .

What experimental approaches are appropriate for functional characterization of YPN_0358?

Given the limited knowledge about YPN_0358's function, a multi-faceted approach is recommended:

  • Comparative genomics: Analyze conservation across Yersinia species and biovars to identify potential functional significance

  • Protein-protein interaction studies: Conduct co-immunoprecipitation experiments similar to those used in DNM2 protein studies

  • Knockout/knockdown studies: Generate YPN_0358 deletion mutants to assess phenotypic changes

  • Localization studies: Use fluorescently tagged versions to determine cellular localization

  • Transcriptomic analysis: Compare expression profiles between wild-type and YPN_0358 mutants under various conditions

When designing knockout experiments, consider using single-subject experimental design (SSED) principles to establish causality between YPN_0358 and observed phenotypes .

What are the recommended approaches for structural studies of YPN_0358?

For structural characterization of YPN_0358, researchers should consider:

  • X-ray crystallography:

    • Optimize protein expression with minimal flexible regions

    • Screen multiple buffer conditions for crystallization

    • Consider surface entropy reduction mutations to promote crystal contacts

  • NMR spectroscopy (for solution structure):

    • Isotope labeling with 15N and 13C

    • Start with 1H-15N HSQC to assess protein folding

    • Progress to 3D experiments for backbone and side-chain assignments

  • Cryo-electron microscopy:

    • Particularly useful if YPN_0358 forms larger complexes

    • May provide structural insights even without crystals

  • Computational approaches:

    • Use AlphaFold2 or similar AI-based tools for structure prediction

    • Validate computational models with experimental data

The future of structural studies for proteins like YPN_0358 is promising with the advancement of AI-based protein structure prediction technologies such as AlphaFold2 .

What strategies can be employed to identify potential binding partners of YPN_0358?

To identify interaction partners of YPN_0358, consider these approaches:

  • Yeast two-hybrid screening:

    • Use YPN_0358 as bait against a Y. pestis genomic library

    • Validate interactions through secondary screening

  • Pull-down assays coupled with mass spectrometry:

    • Use His-tagged YPN_0358 as bait

    • Identify co-purifying proteins by LC-MS/MS

    • Validate with reciprocal pull-downs

  • Proximity-dependent biotin labeling (BioID or APEX):

    • Express YPN_0358 fused to a biotin ligase in Y. pestis

    • Identify proximal proteins through streptavidin purification

  • Co-immunoprecipitation studies:

    • Similar to the approach used in DNM2 protein research

    • Use antibodies against YPN_0358 or its tagged version

  • Surface Plasmon Resonance:

    • Determine kinetic constants for protein-protein interactions

    • Similar to the approach used in studying DciA loader interactions with helicase

Each method has strengths and limitations, so combining multiple approaches provides more robust results.

How can researchers assess the role of YPN_0358 in Yersinia pestis pathogenicity?

To investigate the potential role of YPN_0358 in pathogenicity:

  • Gene knockout studies:

    • Generate YPN_0358 deletion mutants

    • Compare virulence in animal models using controlled experimental design

    • Assess colonization, dissemination, and host survival

  • Transcriptomic analysis:

    • Compare gene expression profiles between wild-type and ΔYpn_0358 strains

    • Focus on known virulence pathways

    • Identify regulatory networks involving YPN_0358

  • Host-pathogen interaction studies:

    • Assess interactions with host immune cells

    • Measure survival in macrophages

    • Evaluate inflammatory responses

  • Phenotypic microarrays:

    • Screen for growth differences under hundreds of conditions

    • Identify metabolic pathways potentially linked to YPN_0358

When designing infection experiments, carefully consider appropriate controls and ensure statistical power through adequate replication, following principles of experimental design .

What are the considerations for subtyping and comparative genomics involving YPN_0358?

When conducting comparative genomics involving YPN_0358:

  • Sequence analysis across different Y. pestis strains:

    • Compare YPN_0358 conservation across biovars (Antiqua, Medievalis, Orientalis)

    • Identify potential selective pressures through dN/dS ratio analysis

  • Integrate with established subtyping methods:

    • Multiple-Locus Variable Number Tandem Repeats (MLVA)

    • Single Nucleotide Polymorphisms (SNPs)

    • Clustered Regularly Interspaced Palindromic Repeats (CRISPR)

  • Phylogenetic analysis:

    • Place YPN_0358 variants in evolutionary context

    • Compare with related species like Y. pseudotuberculosis

The evolution of subtyping methods for Y. pestis has progressed from ribotyping and plasmid analysis to higher-resolution genomic approaches , providing context for understanding the significance of specific proteins like YPN_0358.

What methodological approaches are recommended for site-directed mutagenesis of YPN_0358?

For site-directed mutagenesis studies of YPN_0358:

  • Target selection:

    • Prioritize conserved residues identified through sequence alignment

    • Focus on predicted functional domains

    • Consider surface-exposed residues for interaction studies

  • Mutagenesis techniques:

    • PCR-based methods (QuikChange or overlap extension PCR)

    • Gibson Assembly for more complex modifications

    • CRISPR-Cas9 for genomic modifications in Y. pestis

  • Validation strategies:

    • Sequencing to confirm mutations

    • Protein expression and solubility assessment

    • Functional assays to determine effects of mutations

  • Experimental design considerations:

    • Include appropriate controls (wild-type protein, non-relevant mutations)

    • Consider creating a panel of mutations rather than individual ones

    • Use structure-based predictions to guide mutation selection

This approach can help identify key residues involved in protein-protein interactions, similar to the strategy used in mapping the UvrA-UvrB complex in Mycobacterium tuberculosis .

How might YPN_0358 research contribute to understanding plague transmission dynamics?

Research on YPN_0358 could provide insights into Y. pestis transmission and persistence:

  • Environmental survival:

    • Investigate whether YPN_0358 contributes to survival outside hosts

    • Assess expression under different environmental conditions

    • Determine if it plays a role in soil persistence, which has been hypothesized as a potential inter-epizootic reservoir

  • Host adaptation:

    • Compare expression in different hosts (rodents, fleas, humans)

    • Assess role in adaptation to host environments

    • Determine contribution to vector-borne transmission

  • Biofilm formation:

    • Investigate potential role in biofilm development

    • Assess contribution to survival in flea vectors

Understanding proteins involved in environmental persistence could help explain plague's epidemiological patterns and periodic resurgence, addressing questions about how Y. pestis maintains itself between outbreaks .

What considerations should be made when designing controlled experiments to study YPN_0358 in pathogenicity models?

When designing pathogenicity experiments:

  • Animal models:

    • Select appropriate models (mice are standard for Y. pestis)

    • Consider route of infection (subcutaneous, intranasal, etc.)

    • Include appropriate controls (wild-type, complemented mutants)

  • Experimental design principles:

    • Define clear variables (independent: YPN_0358 presence/absence; dependent: survival, bacterial load, etc.)

    • Establish appropriate sample sizes through power analysis

    • Include randomization and blinding where possible

    • Follow appropriate biocontainment procedures for Y. pestis

  • Data collection and analysis:

    • Establish predetermined endpoints

    • Use appropriate statistical methods for data analysis

    • Consider both statistical and biological significance

  • Ethical considerations:

    • Follow institutional animal care guidelines

    • Implement replacement, reduction, and refinement principles

    • Obtain proper approvals for working with select agents

How can proteomics approaches be optimized for studying YPN_0358 interactions?

To optimize proteomic studies of YPN_0358:

  • Sample preparation:

    • Use optimized lysis buffers to maintain protein interactions

    • Consider crosslinking approaches to capture transient interactions

    • Implement subcellular fractionation to enrich for relevant compartments

  • Mass spectrometry approaches:

    • Consider both data-dependent and data-independent acquisition

    • Implement appropriate controls (non-specific binding, technical replicates)

    • Use labeled techniques (TMT, SILAC) for quantitative comparisons

  • Data analysis:

    • Apply stringent filtering to reduce false positives

    • Use appropriate statistical methods for interaction confidence

    • Validate key interactions through orthogonal methods

    • Integrate with existing interactome data

  • Validation studies:

    • Confirm key interactions through co-immunoprecipitation

    • Assess direct binding through Surface Plasmon Resonance

    • Consider functional validation through genetic approaches

Integration of proteomics data with functional studies provides a more comprehensive understanding of YPN_0358's role within the bacterial cell.

What emerging technologies might advance our understanding of YPN_0358 function?

Several emerging technologies show promise for YPN_0358 research:

  • AI-based protein structure prediction:

    • AlphaFold2 and similar tools can provide structural insights without crystallization

    • These predictions can guide experimental design for functional studies

  • High-throughput CRISPR screening:

    • Systematic genetic interaction mapping to identify functional relationships

    • CRISPRi for tunable repression to study essential genes

  • Single-cell approaches:

    • Single-cell RNA-seq to assess heterogeneity in bacterial populations

    • Time-lapse microscopy with fluorescent reporters to track protein dynamics

  • Advanced imaging techniques:

    • Super-resolution microscopy for precise localization

    • CLEM (Correlative Light and Electron Microscopy) for structural context

These technologies will likely contribute to a more comprehensive understanding of YPN_0358's structure, function, and role in Y. pestis biology .

How can knowledge about YPN_0358 contribute to broader Yersinia pestis research?

Understanding YPN_0358 has several potential applications:

  • Evolutionary insights:

    • Contribute to understanding Y. pestis evolution from Y. pseudotuberculosis

    • Provide markers for epidemiological studies and subtyping

  • Pathogenesis mechanisms:

    • Identify novel virulence mechanisms

    • Understand adaptation to different hosts and environments

  • Diagnostic applications:

    • Develop new biomarkers for Y. pestis identification

    • Improve subtyping methods for epidemiological tracking

  • Therapeutic targets:

    • Assess potential as a novel drug target

    • Explore vaccine development applications

Research on individual proteins like YPN_0358 contributes to the broader understanding of Y. pestis biology and may lead to improved strategies for plague prevention and control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.