Recombinant Yersinia pestis bv. Antiqua UPF0761 membrane protein YPA_3514 (YPA_3514)

What is the structural composition of Recombinant Yersinia pestis bv. Antiqua UPF0761 membrane protein YPA_3514?

Recombinant Yersinia pestis bv. Antiqua UPF0761 membrane protein YPA_3514 is a full-length protein comprising 294 amino acids. The protein features an N-terminal His tag when expressed recombinantly. The amino acid sequence is: MASFRRFRLLSPLKPCVTFGRMLYTRIDKDGLTMLAGHLAYVSLLSLVPLITVIFALFAAFPMFAEISIKLKAFIFANFMPATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSV DSVLNIIWRSKIQRSLVFSFAVYWMVLTLGPILVGASMVISSYLLSLHWLAHARVDSMIDEILRVFPLLISWVSFWLLYSVVPTVRVPARDALIGALVAALLFELGKKGFAMYITLFPSYQLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAERHHAKSVTTQSPEM . The structure suggests multiple transmembrane domains consistent with its classification as a membrane protein, though crystal structure studies would be needed for definitive confirmation of tertiary structure.

How should researchers optimize storage conditions for maintaining protein stability?

For optimal stability of Recombinant Yersinia pestis bv. Antiqua UPF0761 membrane protein YPA_3514, researchers should follow a structured storage protocol. Upon receipt, the lyophilized protein should be briefly centrifuged to ensure all material is at the bottom of the vial. Long-term storage should be maintained at -20°C to -80°C with aliquoting to prevent freeze-thaw cycles . Working aliquots can be stored at 4°C for up to one week to minimize protein degradation from repeated temperature changes. When reconstituting, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, followed by addition of glycerol to a final concentration of 50% for cryoprotection . This methodology preserves protein structure and function while minimizing aggregation or proteolytic degradation that could compromise experimental outcomes.

What expression systems are most suitable for producing functional YPA_3514 protein?

E. coli expression systems have been successfully employed for the recombinant production of YPA_3514 protein . When designing an expression protocol, researchers should consider several methodological factors. The bacterial expression system should be optimized for membrane protein expression, potentially using strains like BL21(DE3), C41(DE3), or C43(DE3) that are engineered to handle membrane proteins. Expression should be conducted at lower temperatures (16-25°C) to allow proper folding. Induction conditions must be calibrated, typically using IPTG at concentrations between 0.1-0.5 mM. For purification, a combination of techniques should be employed, beginning with affinity chromatography exploiting the His-tag, followed by size exclusion chromatography to ensure homogeneity. The buffer system should contain appropriate detergents (e.g., DDM, LDAO) to maintain membrane protein solubility throughout the purification process.

How can researchers effectively design experiments to study YPA_3514 functional characteristics?

When designing experiments to study the functional characteristics of YPA_3514, researchers should follow a systematic approach based on established experimental design principles. Begin by defining clear variables: the independent variable(s) you'll manipulate (e.g., protein concentration, pH, temperature, or presence of binding partners) and the dependent variable(s) you'll measure (e.g., binding affinity, enzymatic activity, or structural changes) . Formulate a specific, testable hypothesis based on preliminary data or literature regarding membrane proteins with similar domains.

Design your experimental treatments with appropriate controls, including:

• Negative controls (buffer only, inactive protein mutants)

• Positive controls (known functional membrane proteins)

• Dose-response relationships where applicable

Use a multi-method research approach, combining techniques such as:

Control extraneous variables by standardizing buffer conditions, protein batch preparation, and environmental factors. Consider using within-subject designs for comparative analyses to minimize variability . Implement rigorous statistical planning, determining sample sizes through power analysis to ensure reliable detection of effects while minimizing type I and type II errors.

What methodologies should be employed to resolve contradictory data regarding YPA_3514 membrane insertion topology?

Resolving contradictory data regarding YPA_3514 membrane insertion topology requires a multi-faceted methodological approach that triangulates evidence from complementary techniques. First, conduct a comprehensive analysis of the amino acid sequence using multiple topology prediction algorithms (TMHMM, TOPCONS, MEMSAT) and compare their outputs systematically in a table format. Discrepancies between predictions highlight regions requiring focused experimental validation.

Implement at least three independent experimental approaches:

• Substituted cysteine accessibility method (SCAM):

  • Introduce cysteine residues at predicted boundary regions

  • Test accessibility to membrane-impermeable and permeable thiol-reactive reagents

  • Map accessible regions to cytoplasmic or periplasmic domains

• Fluorescence quenching analysis:

  • Insert environmentally sensitive fluorescent probes at key positions

  • Measure quenching by water-soluble and membrane-restricted quenchers

  • Determine exposure patterns consistent with specific topological models

• Protease protection assays:

  • Express the protein in membrane vesicles of defined orientation

  • Treat with proteases under controlled conditions

  • Identify protected fragments through mass spectrometry

When encountering contradictory results, implement a Bayesian statistical framework to weight evidence based on methodological reliability. Cross-validate findings using knockout/complementation studies to correlate topology with function. The resolution of contradictions often emerges from identifying condition-dependent topology switching or recognizing limitations in specific methodologies under particular experimental conditions.

How can researchers effectively analyze structure-function relationships in YPA_3514 using site-directed mutagenesis?

Analyzing structure-function relationships in YPA_3514 using site-directed mutagenesis requires a systematic experimental design that targets specific structural elements hypothesized to be functionally significant. Begin with computational analysis to identify conserved residues and motifs through multiple sequence alignments with homologous proteins across bacterial species. Structural prediction algorithms should be used to identify putative functional domains, particularly transmembrane regions, binding sites, and catalytic motifs.

Design a mutation strategy addressing three key categories:

Generate multiple mutants using site-directed mutagenesis protocols optimized for membrane proteins, with verification by sequencing before expression. Express each mutant under identical conditions using the E. coli system documented for the wild-type protein . Purify proteins using standardized protocols and assess structural integrity through circular dichroism and thermal stability assays to distinguish functional from structural defects.

For functional characterization, implement a multi-parameter assessment including:

• Membrane localization assays (fluorescence microscopy, membrane fractionation)

• Binding assays for interaction partners

• Activity assays relevant to hypothesized function

• Stability measurements (thermal shift assays, protease susceptibility)

Analyze data using structure-based clustering of mutations and their effects, creating functional heat maps mapped to the predicted protein structure. This methodology allows for identification of functional hotspots and cooperative regions within the protein structure.

What purification strategies yield highest purity and activity for YPA_3514 protein?

Purification of membrane proteins like YPA_3514 requires specialized methodologies to maintain structural integrity while achieving high purity. Based on the His-tagged recombinant expression system documented for YPA_3514 , the following optimized purification strategy is recommended:

• Cell Lysis and Membrane Preparation:

  • Harvest cells through centrifugation (6,000 × g, 15 min, 4°C)

  • Resuspend in lysis buffer containing protease inhibitors

  • Disrupt cells using sonication or high-pressure homogenization

  • Remove cell debris by low-speed centrifugation (10,000 × g, 20 min, 4°C)

  • Isolate membranes by ultracentrifugation (100,000 × g, 1 h, 4°C)

• Membrane Protein Solubilization:

  • Resuspend membrane pellet in solubilization buffer

  • Test multiple detergents systematically (Table 1)

  • Solubilize at 4°C with gentle agitation for 1-2 hours

  • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min, 4°C)

• Immobilized Metal Affinity Chromatography:

  • Load solubilized protein onto Ni-NTA resin equilibrated with binding buffer

  • Wash extensively with stepped imidazole concentrations (10 mM, 20 mM, 40 mM)

  • Elute with 250-300 mM imidazole

• Size Exclusion Chromatography:

  • Apply concentrated IMAC eluate to Superdex 200 column

  • Collect monodisperse peak fractions

  • Verify purity by SDS-PAGE (>90% purity)

• Protein Stabilization:

  • Exchange into storage buffer containing 6% trehalose in Tris/PBS buffer (pH 8.0)

  • Add glycerol to 50% final concentration for long-term storage

This multi-step purification approach consistently yields protein of greater than 90% purity as determined by SDS-PAGE , with optimal preservation of structural integrity and functional activity. Throughout the purification process, maintain temperature at 4°C and include quality control checkpoints after each major purification step.

How should researchers design control experiments when studying YPA_3514 function in membrane systems?

Designing robust control experiments is essential for validating functional studies of YPA_3514 in membrane systems. A comprehensive control strategy should address four key experimental vulnerabilities: specificity, technical artifacts, environmental factors, and biological variability.

First, implement specificity controls to verify that observed effects are directly attributable to YPA_3514:

• Negative Controls:

  • Empty vector-transformed cells/membrane preparations

  • Heat-denatured YPA_3514 protein

  • Structurally similar but functionally distinct membrane proteins

• Positive Controls:

  • Well-characterized membrane proteins with similar predicted functions

  • Defined artificial membrane systems with known properties

• Dose-Dependency Controls:

  • Titration series of YPA_3514 concentration

  • Competition assays with unlabeled proteins/ligands

For technical validation, implement the following controls:

Environmental controls should standardize and monitor:

• Temperature stability (±0.5°C)

• pH consistency (±0.1 units)

• Ionic strength of buffers

• Oxidation/reduction potential

Biological validation requires:

• Multiple protein preparations to control for batch effects

• Expression in different E. coli strains to control for host effects

• Testing in various membrane compositions to assess lipid requirements

• In vivo complementation of YPA_3514 knockout mutants where appropriate

For data interpretation, establish clear acceptance criteria before experimentation begins, determining the minimum effect size considered biologically relevant. Implement appropriate statistical analyses, including tests for normality and homogeneity of variance. When reporting results, explicitly document all control experiments performed and their outcomes, even when results were negative, to enable comprehensive evaluation of experimental rigor.

What methodologies can effectively analyze YPA_3514 oligomerization states in membrane environments?

Analyzing YPA_3514 oligomerization states in membrane environments requires specialized methodologies that accommodate the unique challenges of membrane protein biochemistry. A multi-technique approach is recommended to provide complementary data and cross-validation.

Begin with biochemical techniques optimized for membrane proteins:

• Chemical Cross-linking Analysis:

  • Titrate cross-linkers of varying spacer arm lengths (DSS, DSP, BS3)

  • Perform time-course studies to capture transient interactions

  • Analyze cross-linked products by SDS-PAGE and immunoblotting

  • Identify cross-linked species by mass spectrometry

• Blue Native PAGE:

  • Solubilize membranes in mild detergents (digitonin, DDM)

  • Run parallel samples with varying detergent concentrations

  • Compare migration patterns against known molecular weight standards

  • Perform second-dimension SDS-PAGE to verify subunit composition

For biophysical characterization, implement:

Advanced structural techniques provide higher resolution information:

• Cryo-Electron Microscopy:

  • Prepare YPA_3514 in nanodiscs or amphipols

  • Image under varying protein concentrations

  • Perform 2D classification to identify distinct oligomeric states

  • Generate 3D reconstructions of predominant species

• Mass Photometry:

  • Measure mass distribution of individual particles in solution

  • Quantify proportions of different oligomeric species

  • Monitor concentration-dependent oligomerization

For in vivo validation, implement genetic fusion approaches:

• BRET/FRET pairs to measure proximity in living cells

• Split-protein complementation assays to confirm interactions

• Two-hybrid systems modified for membrane proteins

Data analysis should integrate results from multiple techniques to build a coherent model of oligomerization behavior. Consider how detergent choice, lipid composition, protein concentration, and buffer conditions affect observed oligomerization states. Systematic variation of these parameters can reveal physiologically relevant determinants of YPA_3514 quaternary structure.

How should researchers resolve contradictory findings in YPA_3514 localization studies?

Resolving contradictory findings in YPA_3514 localization studies requires a methodical approach that addresses potential sources of discrepancy while implementing complementary techniques for validation. First, conduct a systematic literature review to document all reported localization patterns, experimental conditions, and methodologies. Organize findings in a comprehensive table highlighting contradictions and consistencies.

Implement a multi-level investigation strategy:

• Methodological Assessment:

  • Evaluate antibody specificity through Western blots against wild-type and knockout strains

  • Test multiple fixation protocols (paraformaldehyde, glutaraldehyde, methanol)

  • Compare detergent-based permeabilization methods (Triton X-100, saponin, digitonin)

  • Assess tag interference by comparing N-terminal, C-terminal, and internal tags

• Biological Variables Analysis:

  • Test localization across growth phases (log, stationary) and stress conditions

  • Examine strain differences that might affect trafficking machinery

  • Evaluate effects of culture media composition on expression and localization

  • Assess temperature-dependent localization patterns

• Complementary Localization Techniques:

• Quantitative Analysis:

  • Implement colocalization analyses with established membrane markers

  • Calculate Pearson's correlation coefficients and Mander's overlap coefficients

  • Perform time-lapse analysis to detect dynamic localization changes

  • Use super-resolution techniques (STORM, PALM) for precise spatial distribution

When contradictions persist, consider the possibility of condition-dependent localization or multiple populations of YPA_3514 with distinct localizations. Develop a unified model that accommodates seemingly contradictory findings by identifying the specific biological or experimental conditions that determine particular localization patterns. This approach transforms apparent contradictions into a more comprehensive understanding of YPA_3514 biology.

What statistical approaches are most appropriate for analyzing YPA_3514 structure-function data?

When analyzing structure-function data for YPA_3514, researchers should implement a comprehensive statistical framework that addresses the complexity of membrane protein biology while maintaining statistical rigor. The appropriate statistical approaches depend on the experimental design, data structure, and specific hypotheses being tested.

For mutational analysis datasets, implement the following statistical framework:

• Exploratory Data Analysis:

  • Assess data distributions using Shapiro-Wilk tests for normality

  • Identify outliers using Grubbs' test or modified Z-scores

  • Examine variance patterns using Levene's test

  • Create correlation matrices to identify relationships between functional parameters

• Hypothesis Testing Framework:

• Advanced Statistical Modeling:

  • Principal Component Analysis (PCA) to identify correlated functional parameters

  • Hierarchical clustering to group mutations with similar functional impacts

  • Multiple regression to model structure-function relationships

  • Machine learning approaches (Random Forest, SVM) for complex pattern recognition

• Statistical Power and Validity:

  • Conduct a priori power analysis to determine sample sizes

  • Calculate effect sizes (Cohen's d, η²) to assess biological significance

  • Implement false discovery rate control for multiple comparisons

  • Validate findings through bootstrap resampling or cross-validation

For publication and reporting, adhere to these guidelines:

• Present raw data in supplementary materials for reproducibility

• Report exact p-values rather than significance thresholds

• Include confidence intervals for all parameter estimates

• Specify assumptions tested and any transformations applied

• Create informative visualizations that clearly communicate statistical relationships

How can researchers effectively integrate multiple datasets to build comprehensive models of YPA_3514 function?

Integrating multiple datasets to build comprehensive models of YPA_3514 function requires a systematic data integration framework that harmonizes diverse experimental approaches while accounting for methodological differences. The goal is to construct a unified functional model that leverages complementary strengths of various techniques while mitigating their individual limitations.

Implement this data integration process through a structured workflow:

• Data Preparation and Harmonization:

  • Standardize data formats across experimental platforms

  • Normalize datasets to account for systematic differences in scale and variance

  • Annotate datasets with experimental metadata (conditions, replicates, controls)

  • Assess data quality using technique-specific metrics

• Multi-omics Integration Strategy:

• Computational Modeling Approaches:

  • Implement Bayesian network models to integrate probabilistic relationships

  • Develop constraint-based models incorporating thermodynamic and kinetic parameters

  • Utilize machine learning to identify patterns across heterogeneous datasets

  • Construct ordinary differential equation models for dynamic behaviors

• Model Validation and Refinement:

  • Perform cross-validation by systematically withholding datasets

  • Generate testable predictions for experimental validation

  • Implement sensitivity analysis to identify robust model components

  • Refine model parameters through iterative experimentation

• Visualization and Interpretation:

  • Create integrated visualization platforms linking structural and functional data

  • Develop interactive models allowing exploration of parameter spaces

  • Implement dimensionality reduction techniques for complex dataset visualization

  • Construct comparative visualizations across experimental conditions

This integrated modeling approach should explicitly address inconsistencies between datasets by identifying their methodological or biological origins. When datasets appear contradictory, frame these contradictions as testable hypotheses rather than limitations. The resulting comprehensive model should define the scope of certainty while highlighting areas requiring further investigation, creating a dynamic framework that evolves with new experimental evidence rather than a static representation of current knowledge.