Recombinant Yersinia pestis Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Description

Production and Characterization of Recombinant Yersinia pestis CLS

Recombinant Yersinia pestis CLS is produced in E. coli as a full-length protein (1–486 amino acids) with an N-terminal His-tag for affinity purification. Key production parameters include:

ParameterDetailsSources
SpeciesYersinia pestis (strains Pestoides F, Angola, Antiqua)
Uniprot IDA4TJ85, A9R8K8, Q1C7R0
Storage BufferTris-based buffer with 50% glycerol (pH 8.0)
ApplicationsELISA, SDS-PAGE, biochemical assays
Purity>90% as determined by SDS-PAGE

The enzyme is stored at -20°C or -80°C to maintain stability, with working aliquots kept at 4°C for short-term use .

Research Applications and Potential

Recombinant Yersinia pestis CLS is used in:

  • ELISA: For detecting anti-CLS antibodies or studying protein-protein interactions .

  • Biochemical Assays: To analyze substrate specificity and inhibition kinetics .

  • Structural Studies: To investigate membrane localization and complex formation with mitochondrial proteins, as observed in Trypanosoma brucei .

Table 2: Amino Acid Sequence Highlights

RegionSequence ExcerptFunction
N-terminalMTTFYTVISWLSVFGYWLLIAGVT... (residues 1–30)Membrane association
Catalytic CoreLHLGKRRAERAKAMWPSTARWL... (residues 70–100)Phosphotransfer activity
C-terminal...FFSPLL (residues 480–486)Stability and protein-protein interactions

Challenges and Future Directions

  • Limited Kinetic Data: No published studies report Yersinia pestis CLS-specific enzymatic parameters (e.g., KmK_m, VmaxV_{max}) .

  • Structural Studies: Crystallography or cryo-EM could resolve the enzyme’s interaction with substrates.

  • Pathogenic Role: Investigating CLS’s contribution to Yersinia pestis virulence, particularly in biofilm formation or flea vector transmission .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
clsA; cls; YPDSF_0947; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVASPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function
Catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does cardiolipin synthase activity influence Y. pestis adaptation to host environments?

The role of cardiolipin synthase in Y. pestis adaptation to different host environments (arthropod vector versus mammalian host) can be investigated using multiple approaches:

Temperature-dependent expression analysis:

  • qRT-PCR to measure cls expression at 26°C (flea temperature) versus 37°C (mammalian host)

  • RNA-seq to assess global transcriptional networks influenced by cls at different temperatures

  • Western blot analysis to quantify protein levels during temperature transitions

Membrane lipid dynamics:

  • Lipidomics to measure cardiolipin content under various environmental conditions

  • Fluorescence anisotropy to assess membrane fluidity changes during temperature shifts

  • Differential scanning calorimetry to determine membrane phase transitions

Y. pestis undergoes significant lipid remodeling during host transitions. Unlike Y. pseudotuberculosis, which produces hexaacylated lipid A at both room and mammalian temperatures, Y. pestis lacks functional lpxL and pagP genes, resulting in tetraacylated lipid A at 37°C . This adaptation helps Y. pestis evade TLR4-mediated immune recognition in mammals.

The presence of lpxP allows Y. pestis to add palmitoleate (C16:1) to form hexaacylated lipid A at lower temperatures typical of the flea environment . The coordinated regulation of lipid composition, including cardiolipin levels, likely contributes to optimal membrane function during these transitions.

Interestingly, the Yersinia murine toxin (Ymt), a phospholipase D, ranks among the top 10 most abundant Y. pestis proteins in flea biofilms , suggesting the importance of phospholipid metabolism during colonization of the vector. The relationship between Ymt and cls in membrane remodeling presents an intriguing area for investigation.

  • What experimental approaches can determine how cls affects outer membrane vesicle (OMV) formation in Y. pestis?

The relationship between cardiolipin synthase and outer membrane vesicle (OMV) formation represents a frontier in Y. pestis research with implications for both basic biology and vaccine development:

Quantitative OMV analysis:

  • Nanoparticle tracking analysis to measure OMV size distribution and concentration

  • Electron microscopy (TEM/SEM/Cryo-EM) to visualize membrane morphology

  • Comparative proteomics of OMVs from wild-type versus cls mutant strains

Membrane curvature assessment:

  • Fluorescence microscopy with cardiolipin-specific probes (e.g., NAO)

  • Atomic force microscopy to measure nanoscale membrane properties

  • Molecular dynamics simulations of membrane curvature influenced by cardiolipin

Genetic engineering approaches:

  • Generation of cls overexpression/underexpression strains to modulate cardiolipin levels

  • Complementation with cls variants harboring mutations in catalytic or regulatory domains

  • Epistasis experiments with other genes known to influence OMV biogenesis (e.g., tolR)

Research on Y. pseudotuberculosis provides valuable insights into this relationship. Studies have demonstrated that a recombinant Y. pseudotuberculosis strain (YptbS44) with modifications to increase OMV production, including deletion of tolR to promote membrane curvature, produced substantially more OMVs containing Y. pestis antigens than the corresponding Y. pestis strain .

Notably, intramuscular immunization with 40 μg of OMVs from YptbS44(pSMV13) (termed OMV YptbS44-Bla-V) afforded complete protection to mice against both pulmonary and subcutaneous Y. pestis infections . The protective efficacy was superior to that of vaccination with the F1V subunit vaccine or OMVs from a recombinant Y. pestis strain.

Since cardiolipin influences membrane curvature and fluidity, modulating cls expression or activity could potentially be exploited to enhance OMV production for vaccine development or to inhibit OMV-mediated virulence factor delivery.

  • How can mutations in cls catalytic domains be designed to investigate structure-function relationships?

Investigating structure-function relationships in Y. pestis cardiolipin synthase requires systematic mutagenesis approaches targeting key domains:

Site-directed mutagenesis strategy:

  • Target conserved HKD motifs in both PLD domains (primary catalytic residues)

  • Modify residues involved in substrate binding or product release

  • Create chimeric constructs with domains from other species to identify functionally important regions

Expression and purification of mutant proteins:

  • Use identical expression systems for wild-type and mutant proteins to enable direct comparison

  • Implement quality control measures (SEC-MALS, thermostability assays) to ensure proper folding

  • Evaluate oligomeric state to detect potential assembly defects

Enzymatic characterization:

  • Determine kinetic parameters (Km, Vmax, kcat) for wild-type and mutant enzymes

  • Assess pH and temperature optima to identify changes in catalytic properties

  • Evaluate substrate specificity using various phospholipid substrates

Structural validation:

  • Circular dichroism spectroscopy to assess secondary structure integrity

  • Limited proteolysis to probe conformational changes

  • Computational modeling to predict effects of mutations

While no crystal structure of Y. pestis cls is currently available in the Protein Data Bank, homology models can be constructed based on related enzymes. The characteristic HKD motifs in PLD domains provide initial targets for mutagenesis.

Research on other phospholipase D family enzymes suggests that mutations in the HKD motifs typically abolish enzymatic activity. For example, studies with cardiolipin synthase from Pseudomonas putida demonstrated that mutation of conserved catalytic residues dramatically affected membrane lipid composition and stress tolerance .

  • What proteomics approaches are most suitable for identifying cls-interacting proteins in Y. pestis?

Identifying the protein interaction network of cardiolipin synthase in Y. pestis requires specialized proteomics approaches suitable for membrane proteins:

Affinity-based approaches:

  • Tandem affinity purification (TAP) using dual-tagged cls

  • Co-immunoprecipitation with antibodies against endogenous cls or epitope tags

  • Proximity labeling techniques (BioID, APEX) to identify spatial neighbors

Crosslinking strategies:

  • Chemical crosslinking followed by mass spectrometry (XL-MS)

  • Photo-activatable crosslinkers for capturing transient interactions

  • In vivo crosslinking to preserve physiologically relevant interactions

Native complex isolation:

  • Blue native PAGE to separate intact membrane protein complexes

  • Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS)

  • Gradient ultracentrifugation to separate complexes by size

Mass spectrometry analysis:

  • Specialized detergent removal prior to MS analysis

  • Data-independent acquisition for comprehensive interaction mapping

  • Quantitative proteomics to determine stoichiometry of interaction partners

The recent proteomics dataset (PXD054825) focused on Y. pestis identification from environmental matrices offers methodological insights applicable to cls interaction studies . The study employed nano-liquid chromatography-tandem mass spectrometry (nLC-MS/MS) for Y. pestis protein analysis, with validation in spiked environmental samples.

When investigating cls interactions, it's important to consider key biological processes that may involve cls. For example, cls may interact with:

  • Other phospholipid biosynthesis enzymes in a metabolic complex

  • Membrane remodeling proteins during stress responses

  • Virulence-associated membrane proteins during host adaptation

Identified interaction partners would provide insights into cls regulation and its role in coordinating membrane composition during Y. pestis lifecycle transitions.

  • How does recombinant Y. pestis cls function compare in biofilm formation between mammalian and flea host conditions?

Investigating the role of cardiolipin synthase in Y. pestis biofilm formation under different host conditions requires specialized experimental approaches:

In vitro biofilm models:

  • Temperature-controlled biofilm systems (26°C for flea vs. 37°C for mammal)

  • Static vs. flow-based biofilm systems to model different niches

  • Microscopy techniques (confocal, electron) to visualize biofilm architecture

Quantitative assessment methods:

  • Crystal violet staining for biomass quantification

  • Metabolic activity assays (e.g., XTT reduction)

  • Live/dead staining to assess viability within biofilms

  • Extracellular matrix component quantification

Expression profiling:

  • qRT-PCR for cls and biofilm-associated genes (hmsHFRS, rcsA, rcsB)

  • Proteomics of biofilm vs. planktonic cells under different conditions

  • Reporter gene fusions to monitor real-time expression changes

Biofilm formation is critical for Y. pestis transmission from fleas to mammals. Research has shown that Y. pestis forms robust biofilms at 26°C (flea temperature) but significantly less at 37°C (mammalian temperature) . This temperature-dependent regulation involves several factors, including the rcs system.

Interestingly, while Y. pseudotuberculosis readily forms biofilms in various environments, it fails to do so in the flea. This difference has been attributed to the pseudogenization of rcsA in Y. pestis . RcsA, a negative regulator of biofilms that is functional in Y. pseudotuberculosis, became a pseudogene in Y. pestis through evolution. Replacement of the Y. pestis rcsA pseudogene with the functional Y. pseudotuberculosis rcsA allele strongly repressed biofilm formation and essentially abolished flea biofilms .

The relationship between cardiolipin content and biofilm formation presents an intriguing research direction. Since biofilm formation involves substantial membrane remodeling, and cardiolipin influences membrane properties, cls may play a role in optimizing membrane composition for biofilm development at different temperatures.

  • What bioinformatic approaches can predict cls inhibitors with potential as anti-plague therapeutics?

Computational approaches to identify potential cardiolipin synthase inhibitors offer a valuable starting point for anti-plague therapeutic development:

Structure-based virtual screening workflow:

  • Homology model generation based on related phospholipase D family enzymes

  • Molecular dynamics simulations to explore conformational flexibility

  • Identification of potential binding pockets (catalytic sites and allosteric sites)

  • Virtual screening of compound libraries against identified pockets

  • Molecular docking to predict binding poses and affinities

  • Pharmacophore modeling based on predicted interactions

  • ADMET property prediction for promising candidates

Machine learning approaches:

  • Training models on known phospholipase inhibitors

  • Quantitative structure-activity relationship (QSAR) modeling

  • Deep learning for novel scaffold identification

  • Automated molecular design using generative models

Integration with experimental validation:

  • Enzymatic assays with purified recombinant cls

  • Bacterial growth inhibition assays under cls-dependent conditions

  • Membrane composition analysis to confirm target engagement

  • Resistance mutation profiling to validate mechanism of action

The presence of two PLD domains with conserved HKD motifs in Y. pestis cls provides well-defined targets for inhibitor design. Since these catalytic domains are essential for enzymatic activity, compounds that interfere with substrate binding or catalysis could potentially impair cardiolipin synthesis.

Given the importance of cardiolipin in bacterial stress responses, cls inhibitors might be particularly effective against Y. pestis during host transitions or in combination with other stressors. Furthermore, since cls is conserved across bacterial species but absent in mammals, it represents a potentially selective target for antimicrobial development.

Recent advances in proteomics methods, such as those described in the PXD054825 dataset , could facilitate target validation by monitoring changes in the Y. pestis proteome following cls inhibition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.