Recombinant Yersinia pestis Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purification

Recombinant Y. pestis plsY is typically produced using Escherichia coli expression systems, providing a scalable method for obtaining purified protein for research applications . The recombinant protein is commonly expressed with affinity tags, most notably His-tags, which facilitate efficient purification through immobilized metal affinity chromatography techniques.

Commercial preparations frequently achieve purities exceeding 90% as determined by SDS-PAGE analysis . After expression and purification, the protein is often lyophilized to enhance stability during storage and transportation.

Catalytic Mechanism

Glycerol-3-phosphate acyltransferase (plsY) catalyzes a critical reaction in bacterial phospholipid biosynthesis:

Acyl-phosphate + Glycerol-3-phosphate → Lysophosphatidic acid + Phosphate

This reaction represents the first committed step in phospholipid formation, creating lysophosphatidic acid, which serves as a precursor for membrane phospholipid biosynthesis. The enzyme's activity is essential for bacterial growth and survival as it directly contributes to membrane formation and integrity.

Role in Phospholipid Biosynthesis Pathway

PlsY functions within a broader metabolic network of phospholipid biosynthesis enzymes. While plsY catalyzes the initial acylation of glycerol-3-phosphate, subsequent enzymes in the pathway further modify the lysophosphatidic acid to generate various membrane phospholipids. This process is crucial for maintaining membrane fluidity, permeability, and structural integrity across varying environmental conditions.

In Y. pestis, the availability of glycerol-3-phosphate (G3P) is influenced by the glycerol metabolism pathway. Research has shown that Y. pestis biovar Orientalis isolates have lost the capacity to ferment glycerol due to a 93 bp in-frame deletion within the glpD gene encoding glycerol-3-phosphate dehydrogenase . This mutation affects aerobic glycerol fermentation, potentially impacting G3P levels and, consequently, the activity of plsY in phospholipid biosynthesis.

Membrane Remodeling and Host Adaptation

Y. pestis exhibits remarkable adaptability between mammalian hosts (37°C) and arthropod vectors or environmental conditions (21°C to 26°C). This transition involves significant membrane remodeling, including changes in the number and length of acyl groups on lipopolysaccharide (LPS) components . As a key enzyme in phospholipid biosynthesis, plsY likely contributes to these temperature-dependent membrane modifications.

The bacterium's ability to remodel its membrane is considered a hallmark of Y. pestis pathogenesis and plays a crucial role in immune evasion strategies . Although the direct involvement of plsY in these processes is not explicitly documented in the available search results, its fundamental role in membrane lipid synthesis suggests potential involvement in adaptive membrane modifications.

Comparison with Other Acyltransferases in Y. pestis

Y. pestis employs multiple acyltransferases that contribute to membrane structure and function. One notable example is PagP, another acyltransferase that specifically modifies lipid A, the endotoxic component of LPS. Interestingly, Y. pestis has evolved to contain a dysfunctional PagP due to a single-nucleotide polymorphism resulting in a premature translation stop . This adaptation results in a hypoacylated lipid A structure that helps Y. pestis evade host immune recognition.

The functional status of different acyltransferases, including plsY and PagP, in Y. pestis highlights the complex evolutionary adaptations this pathogen has undergone to optimize its interactions with different hosts and environmental conditions.

Therapeutic Target Potential

As an essential enzyme for bacterial membrane biosynthesis, plsY represents a potential target for antimicrobial drug development. Inhibitors targeting plsY could disrupt membrane formation in Y. pestis, potentially leading to bacterial cell death or growth inhibition. The availability of recombinant Y. pestis plsY enables high-throughput screening of potential inhibitors and structure-based drug design approaches.

The search for novel antimicrobials is particularly important for pathogens like Y. pestis, which has historical significance as the causative agent of plague and remains a concern for biodefense preparedness. Targeting essential enzymes like plsY could provide new strategies to combat this pathogen.

Metabolic Engineering Applications

Beyond basic research and therapeutic applications, recombinant Y. pestis plsY could have applications in metabolic engineering. Understanding and manipulating phospholipid biosynthesis pathways could lead to the development of engineered bacteria with modified membrane compositions, potentially useful for biotechnology applications or the production of specialized lipids.

Recent research has explored the recreation of Y. pestis lipid A structures in E. coli scaffold genomes, indicating interest in engineering bacterial membrane components for various applications . Similar approaches could potentially utilize plsY and related enzymes to create custom membrane structures with desired properties.

Variations Across Yersinia Species

The plsY enzyme shows conservation across Yersinia species but may exhibit subtle variations that contribute to species-specific membrane characteristics. Comparative analysis of plsY from Y. pestis with homologs from other Yersinia species, such as Y. pseudotuberculosis and Y. enterocolitica, could reveal insights into the evolutionary adaptations of this enzyme family.

Such comparative studies might help explain differences in membrane composition, environmental adaptation, and pathogenicity among Yersinia species, particularly considering the recent evolutionary divergence of Y. pestis from Y. pseudotuberculosis.

Glycerol Metabolism and plsY Function

The relationship between glycerol metabolism and plsY function represents an important aspect of Y. pestis biochemistry. Studies have shown that inactivation of glpD in Y. pestis results in decreased intracellular accumulation of glycerol-3-phosphate, a known inhibitor of cAMP receptor protein (CRP) activation . Since CRP is involved in global regulation in Y. pestis, alterations in G3P levels due to changes in glycerol metabolism could have widespread effects on bacterial physiology, potentially including the function and regulation of plsY.

Future Research Directions

The study of recombinant Y. pestis plsY continues to offer promising avenues for future research, including:

  1. Detailed structural characterization to understand its catalytic mechanism and substrate binding properties

  2. Development and screening of specific inhibitors as potential antimicrobial agents

  3. Investigation of plsY's role in Y. pestis membrane remodeling during temperature shifts and host adaptation

  4. Exploration of potential protein-protein interactions involving plsY in Y. pestis metabolism

  5. Comparative studies across different Y. pestis biovars and related Yersinia species

These research directions could contribute to a more comprehensive understanding of bacterial membrane biosynthesis and potentially lead to new strategies for combating Y. pestis infections.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery estimates, please contact your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution. Store the aliquots at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We select the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
plsY; YPDSF_0431; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-216
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
plsY
Target Protein Sequence
MSAIALGMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGATNVLRIGGRTAAVAVLL FDILKGMLPVWIAYLLHIPPLYLGLTAIAACLGHIYPVFFHFKGGKGVATAFGAIAPIGW DLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFTFPVAMLSCLILMRHHDN IQRLWRGKEGKIWDKLRKKKQKTPAEEAAELEEKED
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). While it utilizes acyl-phosphate as the fatty acyl donor, it does not accept acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems and purification methods are optimal for recombinant Y. pestis plsY?

As an integral membrane protein, plsY presents significant challenges for recombinant expression and purification. The optimal approach involves:

Expression Systems:

  • E. coli-based expression: Using vectors with tightly controlled promoters (T7 or arabinose-inducible systems) and fusion tags (His6, MBP, or SUMO) to enhance solubility and facilitate purification

  • Membrane targeting: Including native signal sequences to ensure proper membrane insertion

  • Growth conditions: Lower temperatures (16-20°C) post-induction to reduce inclusion body formation

Purification Protocol:

  • Membrane fraction isolation: Ultracentrifugation of lysed cells at approximately 100,000 × g

  • Solubilization: Using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at concentrations of 1-2% (w/v)

  • Affinity purification: Immobilized metal affinity chromatography using Ni-NTA resin

  • Size exclusion chromatography: For obtaining homogeneous protein preparations

Storage Considerations:

  • Tris-based buffer (typically 50 mM, pH 7.5-8.0) containing 50% glycerol

  • Storage at -20°C or -80°C to prevent freeze-thaw degradation

  • Working aliquots can be maintained at 4°C for up to one week

The amino acid sequence of Y. pestis plsY (as seen in search results) indicates a hydrophobic protein with multiple transmembrane domains, necessitating detergent stabilization throughout the purification process.

How can researchers develop high-throughput assays for Y. pestis plsY enzymatic activity?

Previous limitations in assaying plsY activity have been addressed through the development of microplate-compatible enzymatic assays. Based on published methodologies, researchers can implement:

Continuous Fluorescence-Based Assay:

  • Principle: Monitor release of inorganic phosphate (one of the reaction products) using a fluorescently labeled phosphate binding protein

  • Adaptation for high-throughput: Host plsY in detergent micelles rather than lipid cubic phase (LCP), enabling compatibility with standard liquid-handling platforms

  • Optimized conditions: With appropriate enzyme loading, reaction velocity remains linear for up to 30 minutes

  • Detection system: Standard plate readers with appropriate excitation/emission settings for the fluorescent phosphate sensor

Kinetic Parameters:

  • Under optimal conditions, plsY demonstrates classic Michaelis-Menten kinetics with a documented Vmax of approximately 57.5 μmol/min

  • Substrate concentrations can be systematically varied to generate complete kinetic profiles

Considerations for Inhibitor Screening:

  • Include appropriate positive controls (known inhibitors of acyltransferases)

  • Implement counter-screening to eliminate compounds that interfere with the detection system

  • Include detergent controls to identify compounds that act by disrupting micelles rather than inhibiting the enzyme

This approach provides a scalable method for screening potential plsY inhibitors as part of antibiotic development efforts targeting this essential enzyme .

What are the structural and functional characteristics that make Y. pestis plsY a potential antibiotic target?

Y. pestis plsY represents an attractive antibiotic target for several compelling reasons:

Essentiality and Conservation:

  • plsY catalyzes an essential step in phospholipid biosynthesis with no alternative metabolic pathways in Y. pestis

  • In many pathogens, plsY is the only acyltransferase catalyzing this critical step

Structural Uniqueness:

  • As a bacterial integral membrane protein, plsY utilizes acyl-phosphate rather than acyl-CoA as substrate, distinguishing it from mammalian counterparts

  • The protein contains unique binding pockets that could be exploited for selective inhibition

Accessibility:

  • Active site topology appears accessible to small molecule inhibitors

  • The acyl-phosphate binding site presents opportunities for competitive inhibitor design

Conservation Across Yersinia Species:

  • High sequence identity among plsY from Y. pestis strains, including different biovars (Antiqua, Mediaevalis, Orientalis)

  • Targeting plsY could potentially address all pathogenic Yersinia species, including Y. pseudotuberculosis

Resistance Considerations:

Developing inhibitors against plsY would represent a novel antibiotic strategy that attacks a metabolic pathway distinct from those targeted by current antibiotics used against Y. pestis, potentially addressing multidrug-resistant strains that have emerged in recent years .

How does Y. pestis plsY compare with homologous enzymes in other bacterial species?

Comparative analysis of plsY across bacterial species reveals important similarities and differences:

Sequence Conservation:

SpeciesSequence Identity (%)Similarity (%)
Y. pseudotuberculosis>95>98
Y. enterocolitica~85~90
E. coli~80~85
S. aureus~40~60

Functional Differences:

  • The Y. pestis plsY shares high conservation with Y. pseudotuberculosis, reflecting their recent evolutionary divergence

  • Despite this genetic similarity, functional adaptations may exist related to the different lifestyles (enteric pathogen vs. vector-borne systemic pathogen)

  • Y. pestis plsY may have adapted to function efficiently across a broader temperature range (20-37°C) compared to related enteric pathogens

  • In many Gram-positive bacteria, plsY serves as the only acyltransferase catalyzing this essential step, while in Y. pestis and other Gram-negative bacteria, complementary systems may exist

Structural Features:

  • All bacterial plsY proteins share core transmembrane topology with multiple membrane-spanning domains

  • The amino acid sequence of Y. pestis plsY (as shown in search results) contains regions highly conserved across bacterial species, likely representing catalytically important domains

  • Surface-exposed epitopes may differ significantly, affecting antibody recognition and potential diagnostic applications

Understanding these similarities and differences has implications for drug development, with the potential for broad-spectrum or selective inhibitors depending on the structural elements targeted.

What complementation assays can be used to validate Y. pestis plsY function?

Several complementation systems have been developed that could be adapted to study Y. pestis plsY function:

Yeast-Based Complementation System:

  • A conditional lethal gat1Δ gat2Δ double mutant system has been established for testing GPAT function

  • This system provides high specificity and avoids false positives encountered in previous assays

  • The yeast complementation approach allows for phenotypic screening of plsY variants in a eukaryotic cellular context

Protocol for Establishing a Y. pestis plsY Complementation System:

  • Generate a conditional plsY mutant using techniques such as:

    • Chromosomal insertion of an inducible promoter upstream of plsY

    • CRISPR interference (CRISPRi) for regulated knockdown

    • Temperature-sensitive alleles

  • Introduce plasmid-encoded wild-type or mutant plsY variants

  • Assess complementation by monitoring:

    • Growth restoration under non-permissive conditions

    • Membrane phospholipid composition

    • Cell morphology and integrity

This approach allows for structure-function analysis of plsY and validation of potential drug targets within the enzyme's structure .

How does temperature affect plsY expression and activity in the context of Y. pestis lifecycle?

Y. pestis experiences significant temperature shifts during its transmission cycle between fleas (~25°C) and mammalian hosts (37°C), with important implications for plsY:

Temperature-Dependent Expression:

  • While specific data for plsY is limited, Y. pestis exhibits extensive temperature-regulated gene expression

  • The F1 capsule antigen, for example, is predominantly produced at 37°C but not at lower temperatures

  • In contrast, the plasminogen activator (PLA) is synthesized at both 20°C and 37°C

  • Temperature regulation of plsY would impact membrane composition during host transitions

Enzymatic Activity Considerations:

  • Membrane fluidity changes significantly between 25°C and 37°C, potentially affecting the microenvironment of membrane-embedded plsY

  • The Type III secretion system in Y. pestis shows temperature-dependent activation, with the low-calcium response occurring at 37°C but not 26°C

  • Similar temperature-sensitive activity might apply to plsY, affecting phospholipid composition

Metabolic Implications:

  • Y. pestis has a complete Embden-Meyerhof pathway but no functional pentose-phosphate pathway due to mutations in zwf

  • The glyoxylate bypass pathway is constitutively expressed in Y. pestis (unlike Y. pseudotuberculosis)

  • These metabolic adaptations may influence the availability of glycerol-3-phosphate substrate for plsY at different temperatures

Experimental approaches to studying temperature effects should include activity assays at multiple temperatures, expression analysis using qRT-PCR, and membrane composition studies across the temperature range experienced during Y. pestis lifecycle.

What methods are available for structure-function analysis of Y. pestis plsY?

Determining the structure-function relationships of Y. pestis plsY requires multifaceted approaches:

Computational Methods:

  • Homology modeling: Based on related bacterial acyltransferases with known structures

  • Molecular dynamics simulations: To predict protein behavior within membrane environments

  • Binding site prediction: To identify potential catalytic residues and inhibitor binding pockets

Experimental Approaches:

  • Site-directed mutagenesis: Systematic mutation of predicted catalytic residues followed by activity assays

  • Limited proteolysis: To identify stable domains and flexible regions

  • Cysteine accessibility studies: For topology mapping of transmembrane regions

  • Chimeric proteins: Swapping domains with homologs to identify functional regions

Structural Biology Techniques:

  • X-ray crystallography: Challenging but possible with appropriate detergent/lipid combinations

  • Cryo-electron microscopy: Increasingly applicable to membrane proteins

  • NMR studies: For specific domains or in detergent micelles

  • Hydrogen-deuterium exchange mass spectrometry: To identify regions involved in substrate binding

Functional Validation:

  • Complementation assays in conditional Y. pestis plsY mutants

  • In vitro activity assays with purified enzyme variants

  • Inhibitor binding studies using thermal shift assays or isothermal titration calorimetry

These approaches can identify critical residues involved in catalysis and substrate binding, providing a foundation for rational drug design targeting this essential enzyme.

How does plsY interact with other components of the Y. pestis phospholipid biosynthesis pathway?

plsY functions within an integrated phospholipid biosynthesis pathway, with several important interactions:

Key Interactions:

  • Upstream Enzymes:

    • plsX: Generates acyl-phosphate from acyl-ACP, providing substrate for plsY

    • Potential metabolic channeling between plsX and plsY for efficient substrate transfer

  • Downstream Processing:

    • plsC (1-acylglycerol-3-phosphate acyltransferase): Uses LPA produced by plsY to form phosphatidic acid

    • CdsA (phosphatidate cytidylyltransferase): Converts PA to CDP-diacylglycerol

  • Regulatory Interactions:

    • Coordination with fatty acid synthesis pathways

    • Potential feedback inhibition by downstream products

    • Integration with membrane stress response systems

Specialized Y. pestis Considerations:

  • Y. pestis undergoes significant physiological transitions between hosts

  • The glycerol-phosphate transport system may interact with plsY to ensure substrate availability

  • The constitutive expression of the glyoxylate bypass pathway in Y. pestis (unlike Y. pseudotuberculosis) may influence carbon flux toward phospholipid synthesis

Understanding these pathway interactions is critical for comprehensive targeting of Y. pestis membrane biosynthesis and for predicting metabolic consequences of plsY inhibition.

What animal models are appropriate for studying Y. pestis plsY inhibitors in vivo?

Evaluating plsY inhibitors against Y. pestis requires appropriate animal models that recapitulate key aspects of plague pathogenesis:

Established Y. pestis Animal Models:

  • Mouse Models:

    • Swiss Webster mice: Used for both bubonic and pneumonic plague studies

    • Complete protection against intranasal Y. pestis challenge has been demonstrated in vaccine studies using these mice

  • Rat Models:

    • Brown Norway rats: Susceptible to aerosolized Y. pestis challenge

    • Studies have shown bacterial dissemination patterns in lungs, liver, spleen, and blood

Challenge Route Considerations:

  • Bubonic plague model: Subcutaneous injection mimicking flea bite

  • Pneumonic plague model: Intranasal or aerosol challenge

    • Aerosol challenge using a sparging liquid aerosol generator (SLAG) and nose-only exposure system has been established

    • Challenge doses are calculated using Guyton's formula

Infection Parameters:

  • LD50 values:

    • The aerosol infectious dose of Y. pestis is estimated between 100 and 15,000 organisms in humans

    • In animal models, challenge doses are typically reported in multiples of LD50

    • Studies have used 240 LD50 (2.4 × 104 CFU) for intranasal challenge

    • Aerosol challenges have used up to 465 LD50 (9.3 × 105 CFU) in rat models

Biocontainment Requirements:

  • Work with virulent Y. pestis strains requires BSL-3 facilities

  • Y. pestis CO92 and KIM6+ strains are commonly used for challenge studies

  • The phenotypic pigmentation (Pgm+) status should be confirmed for virulence studies

These animal models provide platforms for testing both the efficacy of plsY inhibitors and their pharmacokinetic properties in the context of Y. pestis infection.

What is the evolutionary significance of plsY in the emergence of Y. pestis from Y. pseudotuberculosis?

The evolutionary relationship between Y. pestis and Y. pseudotuberculosis provides valuable context for understanding plsY function:

Evolutionary Timeline:

  • Y. pestis evolved relatively recently from Y. pseudotuberculosis, with genomic evidence suggesting divergence occurred within the last few thousand years

  • This recent divergence makes the comparison of plsY between these species particularly informative

Genomic Context:

  • The Y. pestis genome shows evidence of "ongoing genome fluidity, expansion and decay"

  • Y. pestis contains approximately 150 pseudogenes, many of which are remnants of an enteropathogenic lifestyle

  • Core metabolic functions like plsY are generally conserved while specialized functions have undergone significant changes

Functional Implications:

  • Despite high sequence conservation, plsY function may be integrated differently into the metabolic networks of Y. pestis compared to Y. pseudotuberculosis

  • Y. pestis has acquired plasmids (pPCP1 and pMT1) that Y. pseudotuberculosis lacks, which encode virulence factors like plasminogen activator

  • The metabolic context in which plsY operates has likely changed to accommodate the vector-borne lifestyle of Y. pestis

Research Significance:

  • Comparative studies of plsY between these species could reveal subtle adaptations in membrane composition related to different transmission mechanisms

  • Understanding these differences could inform the development of species-specific therapeutics

  • The high conservation of plsY underscores its essential role despite dramatic changes in pathogen lifestyle

This evolutionary context enhances our understanding of plsY's role in Y. pestis virulence and adaptation.

How can plsY inhibition be validated as a therapeutic approach against Y. pestis infection?

Validating plsY as a therapeutic target requires a systematic approach:

Genetic Validation:

  • Construct conditional plsY mutants using:

    • Inducible promoter systems

    • Antisense RNA technology

    • CRISPR interference

  • Demonstrate growth dependence in both in vitro and in vivo conditions

  • Assess fitness costs of plsY reduction in different infection models

Chemical Validation:

  • Develop tool compounds with demonstrated on-target activity

  • Establish correlation between:

    • Biochemical inhibition (IC50 values)

    • Cellular activity (MIC values)

    • In vivo efficacy

  • Perform target engagement studies to confirm that compounds reach and inhibit plsY in vivo

Efficacy Metrics:

  • In vitro assessments:

    • Minimum inhibitory concentration (MIC)

    • Time-kill kinetics

    • Post-antibiotic effect

  • In vivo parameters:

    • Bacterial burden reduction in tissues

    • Survival advantage in lethal challenge models

    • Comparison with standard-of-care antibiotics

Resistance Analysis:

  • Generate resistant mutants through serial passage

  • Characterize resistance mechanisms via whole-genome sequencing

  • Assess fitness costs of resistance mutations

  • Develop strategies to address potential resistance

This validation framework would establish whether plsY inhibition can effectively control Y. pestis infection and guide the development of optimized inhibitors for therapeutic use.

What techniques can be used to analyze the effects of plsY inhibition on Y. pestis membrane composition?

Inhibition of plsY would be expected to significantly impact Y. pestis membrane composition, which can be analyzed using multiple complementary approaches:

Lipidomic Analysis:

  • Mass Spectrometry-Based Methods:

    • Liquid chromatography-mass spectrometry (LC-MS) for comprehensive phospholipid profiling

    • Tandem MS for structural characterization of individual lipid species

    • Quantitative analysis using internal standards

  • Thin-Layer Chromatography (TLC):

    • Rapid screening of major phospholipid classes

    • Two-dimensional TLC for improved resolution

    • Densitometric quantification of separated lipids

Membrane Physical Properties:

  • Fluorescence Anisotropy:

    • Measure membrane fluidity changes using fluorescent probes

    • Compare treated and untreated bacterial membranes

  • Differential Scanning Calorimetry:

    • Determine phase transition temperatures

    • Assess membrane organization alterations

Functional Consequences:

  • Membrane Permeability Assays:

    • Uptake of fluorescent dyes (propidium iodide, SYTOX green)

    • Assessment of membrane potential using DiSC3(5)

  • Electron Microscopy:

    • Ultrastructural analysis of membrane morphology

    • Freeze-fracture electron microscopy for lateral organization

  • Atomic Force Microscopy:

    • Nanoscale imaging of membrane surface properties

    • Mechanical property measurements (elasticity, rigidity)

Metabolic Analysis:

  • Metabolic Flux Analysis:

    • Trace incorporation of labeled precursors into membrane lipids

    • Determine alterations in phospholipid turnover rates

These techniques collectively provide a comprehensive view of how plsY inhibition affects membrane composition, structure, and function, which is critical for understanding the mechanism of action and potential cellular adaptations to plsY-targeting therapeutics.

How does Y. pestis plsY contribute to bacterial adaptations during host-vector transitions?

Y. pestis experiences dramatic environmental changes as it cycles between mammalian hosts and flea vectors, with implications for plsY function:

Temperature Adaptation:

  • Transition from flea vector (25°C) to mammalian host (37°C) requires membrane fluidity adjustments

  • plsY activity may be regulated to alter membrane composition during these transitions

  • Changes in acyl chain composition (length and saturation) would affect membrane properties

Metabolic Integration:

  • Y. pestis has genetic adaptations that differentiate it from Y. pseudotuberculosis, including:

    • Constitutive expression of the glyoxylate bypass pathway

    • Mutations in the glucose 6-phosphate dehydrogenase gene (zwf)

  • These metabolic adaptations may influence substrate availability for plsY

Virulence Factor Coordination:

  • Y. pestis virulence factors show temperature-dependent expression:

    • F1 capsule antigen is predominantly produced at 37°C

    • Plasminogen activator (PLA) is synthesized at both 20°C and 37°C

    • Type III secretion system is activated at 37°C under low calcium conditions

  • Membrane composition changes mediated by plsY may support these virulence mechanisms

Research Approaches:

  • Comparative Lipidomics:

    • Analyze membrane composition at different temperatures

    • Compare wild-type and plsY-modulated strains

  • Temperature-Shift Experiments:

    • Monitor plsY expression and activity during temperature transitions

    • Assess membrane adaptation kinetics

  • Vector-Host Models:

    • Study plsY contribution in flea infection models

    • Analyze membrane requirements for successful transmission

Understanding plsY's role in these transitions could reveal vulnerabilities that might be exploited for therapeutic intervention at specific points in the Y. pestis lifecycle.

What are promising research directions for developing plsY-targeted therapeutics against Y. pestis?

Several promising research directions could accelerate the development of plsY-targeted therapeutics:

Structure-Based Drug Design:

  • Structural Determination:

    • Solve the three-dimensional structure of Y. pestis plsY using X-ray crystallography or cryo-EM

    • Develop homology models based on related bacterial acyltransferases

    • Utilize computational approaches to identify binding sites

  • Fragment-Based Screening:

    • Screen fragment libraries against purified plsY

    • Develop structure-activity relationships

    • Employ fragment growing/linking strategies

Innovative Screening Approaches:

  • Whole-Cell Phenotypic Screens:

    • Design reporter systems sensitive to membrane disruption

    • Prioritize compounds with activity under plague-relevant conditions

    • Consider combination approaches with existing antibiotics

  • Substrate Analogs:

    • Develop non-hydrolyzable analogs of acyl-phosphate

    • Create transition-state mimetics

    • Design suicide inhibitors that form covalent adducts with active site residues

Delivery Strategies:

  • Membrane-Targeted Delivery:

    • Develop lipophilic prodrugs to access the membrane environment

    • Utilize bacterial membrane-targeting peptides as delivery vehicles

    • Consider nanoparticle formulations for enhanced delivery

  • Alternative Modalities:

    • Explore antisense approaches targeting plsY expression

    • Investigate CRISPR-based antimicrobials

    • Consider phage-based delivery systems

Combination Approaches:

  • Synergistic Targeting:

    • Identify synergistic combinations with existing antibiotics

    • Target multiple steps in phospholipid biosynthesis

    • Combine with immunotherapeutic approaches

The development of plsY inhibitors would represent a novel class of antibiotics targeting an essential pathway distinct from those affected by current plague therapeutics, potentially addressing the emergence of multidrug-resistant Y. pestis strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.