Recombinant Yersinia pestis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; YPDSF_0160; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
mscL
Target Protein Sequence
MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPLGLLLGGVDFKQFHFV LRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRREKAEEEPATPPAPTTE EILLAEIRDLLKAQHTK
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of the mscL channel in Yersinia pestis virulence?

The large-conductance mechanosensitive channel (mscL) in Y. pestis primarily functions as an emergency release valve that protects bacteria from osmotic shock by opening in response to increased membrane tension. While not directly implicated in the classic virulence mechanisms associated with Y. pestis type III secretion system (T3SS) that delivers effector proteins like YopJ and YopK into host cells , mscL plays a crucial role in bacterial survival during environmental transitions. Y. pestis experiences significant osmotic changes when transitioning between flea vectors and mammalian hosts, making mscL potentially important for maintaining membrane integrity during infection cycles. Research suggests that mscL might indirectly contribute to pathogenesis by enabling bacterial adaptation to different host environments, particularly during early infection stages when the bacterium must adjust to mammalian tissue conditions after being delivered via flea bite .

What expression systems are most effective for producing recombinant Y. pestis mscL?

For recombinant expression of Y. pestis mscL, E. coli-based expression systems using pET vectors with IPTG-inducible promoters have proven most effective, similar to methods used for other Y. pestis proteins . The protocol typically involves cloning the mscL gene into an expression vector with an appropriate affinity tag (commonly a His-tag for ease of purification), transforming into E. coli expression strains (BL21 or derivatives), and inducing expression with IPTG (typically 0.5-1 mM) at 30°C rather than 37°C to improve protein folding. Expression can be optimized by varying parameters including temperature (28-30°C appears optimal for Y. pestis proteins), IPTG concentration, and expression duration (4-6 hours) . Purification is typically achieved via immobilized metal affinity chromatography (IMAC) using Ni-NTA columns under native conditions to maintain protein functionality, followed by size exclusion chromatography to enhance purity .

How does Y. pestis mscL differ structurally from homologous channels in other bacteria?

Y. pestis mscL shares high structural homology with mechanosensitive channels found in other gram-negative bacteria, particularly its close relatives Y. pseudotuberculosis and Y. enterocolitica . The core structure consists of a homopentameric assembly with two transmembrane domains per subunit, creating a channel that expands under membrane tension. While the transmembrane domains are highly conserved across bacterial species, Y. pestis mscL exhibits some unique features in its cytoplasmic C-terminal domain that may affect gating kinetics and tension sensitivity. These differences might contribute to Y. pestis' ability to adapt to the rapid environmental transitions experienced during its complex life cycle between fleas and mammals . Structural analysis through X-ray crystallography or cryo-electron microscopy, combined with site-directed mutagenesis experiments targeting these unique regions, can help elucidate the functional significance of these structural variations.

What purification methods yield functional recombinant Y. pestis mscL suitable for electrophysiology studies?

Obtaining functional Y. pestis mscL for electrophysiology studies requires purification methods that preserve the native conformation and membrane insertion capabilities. The recommended protocol involves: (1) Expressing His-tagged mscL in E. coli as described in FAQ 1.2; (2) Lysing cells using buffer containing 50 mM NaH₂PO₄, 300 mM NaCl, pH 8.0 with gentle detergents like n-dodecyl-β-D-maltoside (DDM, 1%) or n-octyl-β-D-glucopyranoside (OG, 0.8-1%) ; (3) Solubilizing membrane fractions and purifying via Ni-NTA affinity chromatography with detergent-containing buffers; (4) Performing buffer exchange to remove imidazole while maintaining detergent concentration above the critical micelle concentration; and (5) Reconstituting the purified protein into liposomes composed of E. coli lipid extracts or synthetic lipid mixtures (typically 70% phosphatidylethanolamine, 20% phosphatidylglycerol, and 10% cardiolipin). This reconstitution step is critical for electrophysiology studies and can be achieved through detergent removal via dialysis or bio-beads, resulting in proteoliposomes suitable for patch-clamp analysis or planar lipid bilayer recordings.

How might mscL be exploited as a potential vaccine or drug target against Y. pestis infection?

The mscL channel presents a novel therapeutic target against Y. pestis through several potential mechanisms. As a membrane protein essential for osmotic regulation, compounds that specifically lock mscL in an open state could disrupt bacterial membrane potential and induce cell death. For vaccine development, a recombinant approach similar to that used for the LcrV-HSP70 fusion protein could be employed, where mscL or its immunogenic epitopes could be fused with adjuvant proteins. The effectiveness of such an approach would depend on whether antibodies against mscL could inhibit channel function in intact bacteria. A dual-targeting approach combining mscL-based therapeutics with established antigens like LcrV and F1 might provide synergistic protection against Y. pestis infection. Considering reports of antibiotic-resistant Y. pestis strains , targeting mscL could provide an alternative therapeutic strategy less prone to conventional resistance mechanisms. Research should focus on high-throughput screening assays to identify small molecules that specifically modulate Y. pestis mscL function, combined with in vivo studies assessing efficacy in animal models of plague.

What methodologies can effectively assess mscL activation during different stages of Y. pestis infection?

Assessing mscL activation during Y. pestis infection requires sophisticated methodologies spanning molecular, cellular, and in vivo approaches. One effective strategy involves generating reporter strains with fluorescent protein genes fused to mscL promoters, allowing real-time monitoring of expression changes during infection. For direct measurement of channel activity, patch-clamp electrophysiology of bacterial spheroplasts isolated from infected tissues can provide insights into gating properties under physiological conditions. More advanced approaches include: (1) Development of tension-sensitive fluorescent probes that bind specifically to active mscL channels; (2) Implementation of FRET-based biosensors that detect conformational changes in mscL during gating; (3) Application of targeted proteomics to quantify post-translational modifications of mscL during infection stages; and (4) Single-cell microfluidics combined with osmotic shock tests to assess mscL functionality in bacteria isolated from different infection sites. These approaches should be integrated with Y. pestis infection models in fleas and mammals to understand how channel activation correlates with transitions between vector and host environments .

How do mutations in the mscL gene affect Y. pestis survival during transitions between flea vectors and mammalian hosts?

Mutations in the mscL gene significantly impact Y. pestis survival during host-vector transitions through multiple mechanisms. Deletion or loss-of-function mutations in mscL would likely compromise bacterial viability during the osmotic stress encountered when transitioning from the flea midgut to mammalian tissue environments. To investigate this experimentally, isogenic mscL mutant strains can be constructed using lambda Red recombination or CRISPR-Cas9 systems, followed by competitive index assays comparing wild-type and mutant strains in both flea infection models and mammalian hosts. Transmissibility studies using artificial feeding systems with Xenopsylla cheopis fleas can assess whether mscL mutations affect colonization of the flea proventriculus, which is critical for efficient transmission. Additionally, site-directed mutagenesis targeting the tension-sensing domains or channel pore can create gain-of-function or altered-gating mutants to determine how channel kinetics influence bacterial fitness during infection. Y. pestis experiences significant environmental changes during its lifecycle, including temperature shifts (28°C in fleas to 37°C in mammals) and exposure to different immune defenses, making proper osmotic regulation via mscL potentially crucial for pathogenesis .

What are the technical challenges in measuring mechanical tension thresholds of Y. pestis mscL in native versus recombinant systems?

Measuring mechanical tension thresholds of Y. pestis mscL presents significant technical challenges that vary between native and recombinant systems. In native bacterial membranes, the primary challenge is isolating the mscL response from other mechanosensitive channels (including MscS and MscM) that Y. pestis expresses. This necessitates generating clean knockout strains where only mscL remains functional. Patch-clamp electrophysiology on bacterial spheroplasts requires specialized equipment and expertise, particularly challenging with Y. pestis due to biosafety requirements (BSL-3).

In recombinant systems, the major technical challenges include: (1) Ensuring proper folding and pentameric assembly of recombinant mscL in artificial membranes; (2) Recreating the native lipid environment that influences channel gating properties; (3) Developing reliable methods to apply precisely controlled membrane tension in artificial systems; and (4) Accounting for the absence of native interaction partners that might modulate channel function in vivo. Researchers have addressed these challenges through approaches such as: fluorescence-based liposome assays measuring calcein release under osmotic shock; micropipette aspiration techniques applying defined tension to giant unilamellar vesicles containing reconstituted mscL; and development of microfluidic platforms that allow high-throughput analysis of mscL activity under various tension conditions. Comparative studies between recombinant and native systems are essential to validate findings and ensure physiological relevance.

How can molecular dynamics simulations inform the development of mscL-targeting antimicrobials for Y. pestis?

Molecular dynamics (MD) simulations offer powerful insights for developing mscL-targeting antimicrobials against Y. pestis through several approaches. First, all-atom MD simulations of Y. pestis mscL embedded in lipid bilayers can reveal the detailed mechanics of channel gating, identifying critical residues that undergo significant conformational changes during the transition from closed to open states. These simulations typically require several microseconds of simulation time using specialized computing infrastructure and force fields optimized for membrane proteins. Second, targeted MD and steered MD approaches can identify potential binding pockets that appear transiently during channel gating, which would not be evident in static crystal structures. Third, virtual screening against these identified binding sites can prioritize small molecule candidates for experimental validation.

The most promising compounds would be those that either lock the channel in an open state (causing osmotic dysregulation) or prevent channel opening entirely (making bacteria vulnerable to hypoosmotic shock). MD simulations can further predict how resistance mutations might affect binding of these compounds, allowing for proactive design of alternate scaffolds. Integration of these computational approaches with experimental validation through electrophysiology and antimicrobial susceptibility testing could accelerate development of novel therapeutics targeting this essential bacterial survival mechanism, particularly valuable given concerns about antibiotic-resistant strains of Y. pestis .

What are the optimal conditions for reconstituting purified Y. pestis mscL into liposomes for functional studies?

Reconstituting purified Y. pestis mscL into liposomes for functional studies requires careful optimization of multiple parameters. The recommended protocol includes: (1) Preparing a lipid mixture mimicking bacterial membranes—typically 70% phosphatidylethanolamine, 20% phosphatidylglycerol, and 10% cardiolipin dissolved in chloroform; (2) Creating a lipid film by evaporating the chloroform under nitrogen gas followed by vacuum desiccation for 2-3 hours; (3) Hydrating the lipid film with reconstitution buffer (typically 200 mM KCl, 5 mM HEPES, pH 7.2) to form multilamellar vesicles; (4) Performing freeze-thaw cycles (5-10 cycles between liquid nitrogen and 42°C) to improve reconstitution efficiency; (5) Extruding through polycarbonate filters (400-200 nm) to create unilamellar vesicles; (6) Destabilizing preformed liposomes with detergent (Triton X-100 at R-value of 1.5-2.0); (7) Adding purified mscL at protein-to-lipid ratios between 1:50 and 1:200 (w/w); and (8) Removing detergent using Bio-Beads SM-2 through sequential additions (30 mg/mL of solubilized lipids) with overnight incubation at 4°C with gentle agitation.

Critical parameters requiring optimization include the protein-to-lipid ratio, detergent type and concentration, and buffer composition. Functional reconstitution can be verified through osmotic shock assays measuring the release of fluorescent dyes or patch-clamp electrophysiology on giant unilamellar vesicles generated from these proteoliposomes.

How can researchers effectively distinguish the function of mscL from other mechanosensitive channels in Y. pestis?

Distinguishing mscL function from other mechanosensitive channels in Y. pestis requires a comprehensive experimental toolkit combining genetics, electrophysiology, and pharmacology. First, researchers should create clean genetic knockout strains (ΔmscL, ΔmscS, ΔmscL/ΔmscS) using CRISPR-Cas9 or homologous recombination methods. These isogenic strains allow assessment of phenotypic differences in osmotic shock survival and patch-clamp electrophysiology profiles. Second, single-channel patch-clamp recordings can identify mscL based on its distinctive conductance (~3 nS in 200 mM KCl), significantly larger than MscS (~1 nS) or MscM (~0.3 nS). Third, channel-specific pharmacological agents can be employed—gadolinium ions (Gd3+) at low concentrations (1-5 μM) preferentially inhibit MscS while having minimal effect on mscL, while parabens have been reported to specifically affect mscL. Fourth, specific activation thresholds distinguish these channels—mscL typically requires higher membrane tension for activation than MscS (approximately 10-12 mN/m versus 5-7 mN/m).

Finally, researchers can employ fluorescent reporter constructs where different channel promoters drive expression of distinct fluorescent proteins, allowing real-time visualization of differential expression patterns during osmotic stress. Combining these approaches provides robust differentiation between mechanosensitive channel subtypes and their respective contributions to Y. pestis osmotic homeostasis.

What experimental design would best test whether mscL contributes to Y. pestis antibiotic resistance?

An optimal experimental design to test mscL's contribution to Y. pestis antibiotic resistance would employ a multi-faceted approach combining genetic, physiological, and in vivo methods. First, generate isogenic strains including wild-type Y. pestis, ΔmscL knockout, complemented strain (ΔmscL+pmscL), and overexpression strain (WT+pmscL) using molecular techniques adapted from previous Y. pestis genetic modification protocols . Second, perform comprehensive minimum inhibitory concentration (MIC) determination for these strains against multiple antibiotic classes (β-lactams, aminoglycosides, fluoroquinolones, tetracyclines) under standard conditions and osmotic stress conditions (high salt, hypotonic environments). Third, conduct time-kill assays to assess how mscL affects the rate of antibiotic-induced killing and the development of persister cells. Fourth, use fluorescently-labeled antibiotics to measure uptake rates in wild-type versus ΔmscL strains through flow cytometry or microscopy.

Fifth, examine antibiotic efficacy in a structured experimental mouse model of plague by comparing survival rates and bacterial burden in animals infected with wild-type versus ΔmscL Y. pestis and treated with antibiotics at various timepoints post-infection . Finally, investigate potential mechanisms by which mscL might contribute to resistance, including: (a) antibiotic efflux through the channel pore, (b) changes in membrane permeability affecting antibiotic penetration, and (c) altered expression of other resistance determinants in response to mscL deletion. This comprehensive design would provide definitive evidence for any role of mscL in Y. pestis antibiotic resistance, an important consideration given reports of multidrug-resistant strains .

What techniques can detect and quantify conformational changes in mscL during osmotic stress in living Y. pestis cells?

Detecting and quantifying conformational changes in mscL during osmotic stress in living Y. pestis cells requires sophisticated biophysical techniques that can operate in real-time without disrupting cellular integrity. One powerful approach employs site-directed fluorescence labeling where cysteine residues are introduced at strategic positions in the mscL protein that undergo significant movement during gating. These cysteines can be labeled with environment-sensitive fluorophores that change quantum yield or emission wavelength upon channel opening. For implementation in Y. pestis, researchers must first create a cysteine-less mscL variant to eliminate background labeling, then introduce single cysteines at positions known to change environment during gating (typically transmembrane/pore-lining residues).

FRET-based approaches offer another valuable technique, requiring the insertion of fluorescent protein pairs (such as CFP/YFP or mTurquoise/Venus) at positions that change relative distance during channel gating. This approach can be implemented directly in living cells but requires careful validation to ensure the fluorescent protein fusions don't impair channel function. For higher-resolution data, lanthanide-based LRET (Luminescence Resonance Energy Transfer) can be employed. Recently developed techniques such as transition metal ion FRET (tmFRET) and fluorescence quenching by synthetic unnatural amino acids offer higher sensitivity for detecting subtle conformational changes.

To correlate these conformational changes with physiological stress, these techniques must be combined with precise microfluidic systems that allow controlled application of osmotic shock while simultaneously performing fluorescence measurements. For Y. pestis specifically, these systems must comply with appropriate biosafety regulations, typically requiring specialized equipment within BSL-3 facilities.

How should researchers interpret contradictory findings between recombinant mscL behavior in artificial membranes versus native bacterial systems?

When faced with contradictory findings between recombinant Y. pestis mscL behavior in artificial membranes versus native bacterial systems, researchers should conduct a systematic investigation addressing several key factors. First, critically examine the lipid composition differences between artificial systems and Y. pestis membranes. The native Y. pestis membrane has a unique lipid profile that changes between flea and mammalian host environments, potentially affecting mscL gating properties. Researchers should perform comparative studies using liposomes with compositions mimicking both environmental conditions.

Second, investigate the influence of membrane-associated proteins that may modulate mscL function in vivo but are absent in reconstituted systems. Co-immunoprecipitation followed by mass spectrometry can identify potential interaction partners in native membranes. Third, evaluate expression system artifacts such as improper folding, missing post-translational modifications, or incorrect oligomeric assembly in recombinant systems. Native mass spectrometry and circular dichroism spectroscopy can verify proper structure of both native and recombinant channels.

Fourth, consider differences in experimental conditions including temperature, pH, and ionic composition, which should be matched between systems for valid comparisons. Finally, determine whether the contradiction relates to kinetic or equilibrium properties—some discrepancies may be explained by differences in the time resolution of measurement techniques used in different systems. A comprehensive approach would include a side-by-side comparison using identical measurement techniques (such as patch-clamp electrophysiology) applied to both spheroplasts from Y. pestis and proteoliposomes containing recombinant mscL under identical conditions. This systematic investigation framework ensures proper interpretation of seemingly contradictory findings.

What statistical approaches are most appropriate for analyzing mscL gating kinetics data from single-channel recordings?

Analysis of mscL gating kinetics from single-channel recordings requires sophisticated statistical approaches due to the stochastic nature of channel opening and closing events. The most appropriate analytical framework includes: (1) Hidden Markov Models (HMMs) for identifying distinct conductance states and transitions between them, particularly valuable for Y. pestis mscL which may exhibit multiple subconductance states during gating; (2) Dwell-time analysis using maximum likelihood estimation to fit probability density functions (typically exponential or sum of exponentials) to open and closed state durations; (3) Boltzmann distribution analysis to quantify the relationship between applied tension and open probability, determining key parameters such as ΔG and ΔA (change in cross-sectional area) during channel gating.

For more complex analyses, researchers should employ: (4) Information theory approaches such as mutual information analysis to detect correlations between successive gating events; (5) Power spectral density analysis to identify characteristic frequencies in channel activity; and (6) Non-stationary noise analysis to estimate the number of channels in a patch and single-channel conductance from macroscopic current fluctuations. When comparing data across experimental conditions (e.g., different tensions, temperatures, or mutations), appropriate statistical tests include non-parametric methods like the Kolmogorov-Smirnov test for distributions of dwell times and Mann-Whitney U test for median values.

Researchers should be cautious about common statistical pitfalls such as over-fitting HMM models with too many states, failing to account for missed events due to limited recording bandwidth, and ignoring modal gating behavior where channels switch between different activity patterns. Software packages specifically designed for single-channel analysis (QuB, HJCFIT, or custom implementations in programming environments like MATLAB or Python) are recommended for robust implementation of these approaches.

How can comparative genomics inform the interpretation of functional differences between mscL proteins from Y. pestis and other Yersinia species?

Third, researchers should map sequence variations onto known structural domains of mscL, with particular attention to residues lining the channel pore, transmembrane segments interfacing with lipids, and regions involved in tension sensing. Fourth, synteny analysis examining the genomic context of mscL across species may reveal co-evolution with functionally related genes. Fifth, integration of transcriptomic data from different Yersinia species under identical stress conditions can illuminate whether expression regulation differs between species.

To translate these genomic insights into functional understanding, researchers should generate chimeric mscL proteins where domains from different Yersinia species are swapped, followed by functional characterization through patch-clamp electrophysiology and osmotic challenge experiments. Additionally, site-directed mutagenesis targeting identified variable residues can pinpoint specific amino acids responsible for functional differences. This integrated approach allows researchers to connect sequence evolution with channel properties and ultimately with the distinct ecological niches occupied by different Yersinia species, from primarily environmental bacteria to specialized human pathogens like Y. pestis .

What criteria should be used to evaluate the physiological relevance of in vitro mscL functional studies to actual Y. pestis infection dynamics?

Evaluating the physiological relevance of in vitro mscL studies to actual Y. pestis infection dynamics requires establishing rigorous criteria across multiple experimental domains. First, environmental parameters in in vitro experiments should accurately reflect conditions encountered during the Y. pestis lifecycle, including: temperature transitions (28°C in fleas to 37°C in mammals) , pH variations (acidic phagolysosomes versus neutral blood), and osmolarity changes encountered during transmission. Second, temporal dynamics must be considered—acute responses to sudden osmotic shock in laboratory settings should be complemented by studies of prolonged adaptation that better mimic natural infection timeframes.

Third, researchers should establish clear molecular validation criteria, where mscL conformational changes or activation patterns observed in vitro are verified in bacterial cells isolated directly from infected tissues. Fourth, genetic correlation analysis should demonstrate concordance between phenotypes observed in laboratory mutants and bacterial behavior during actual infection—for example, if mscL mutations affect osmotic survival in vitro, similar effects should be observable in bacterial fitness within host tissues.

Fifth, translational relevance must be demonstrated through animal infection models. This requires showing that pharmacological or genetic manipulations of mscL that produce effects in vitro also meaningfully alter infection outcomes in appropriate animal models for plague . A comprehensive validation framework would include a comparative analysis of wild-type and mscL-mutant Y. pestis strains in both flea vector colonization and mammalian infection models, with explicit testing of osmotic stress responses at key transition points. Only when in vitro observations are reproducible across these multiple criteria can researchers confidently assert physiological relevance to actual infection dynamics.

What biosafety considerations are critical when working with recombinant Y. pestis mscL in laboratory settings?

Working with recombinant Y. pestis mscL presents significant biosafety challenges requiring comprehensive protective measures due to Y. pestis's classification as a Tier 1 Select Agent and BSL-3 pathogen. Critical considerations include: (1) Regulatory compliance—research must adhere to local and national regulations governing Select Agent work, requiring approved facilities, security measures, inventory controls, and personnel reliability programs; (2) Facility requirements—work must be conducted in a certified BSL-3 laboratory with negative pressure, HEPA filtration, controlled access, and specialized equipment including biological safety cabinets (Class II, Type A2 or B2); (3) Personnel protection—researchers must use comprehensive personal protective equipment including powered air-purifying respirators (PAPRs) or N95 respirators, disposable gowns, double gloves, and shoe covers, with strict adherence to donning/doffing protocols.

For work specifically with recombinant mscL constructs, additional considerations include: (4) Risk assessment for novel constructs—each recombinant mscL variant should undergo thorough evaluation to determine if modifications could potentially enhance virulence or transmissibility; (5) Containment verification—routine testing of aerosol containment systems and biosafety cabinet function is essential; and (6) Inactivation validation—protocols for sample removal from BSL-3 must be validated to ensure complete inactivation of viable Y. pestis while preserving the structural and functional properties of mscL needed for analysis.

Alternative approaches to reduce risk include: using attenuated Y. pestis strains lacking key virulence plasmids, employing closely related but less pathogenic Yersinia species as surrogates (Y. pseudotuberculosis with recombinant Y. pestis mscL) , or expressing the Y. pestis mscL gene in heterologous non-pathogenic hosts like laboratory E. coli strains . All work must be preceded by comprehensive training in BSL-3 practices, documented in approved protocols, and regularly audited for compliance.

How can researchers address the challenge of maintaining membrane protein stability during purification of Y. pestis mscL?

Maintaining stability during purification of Y. pestis mscL requires addressing several challenges inherent to membrane proteins. A comprehensive strategy includes: (1) Optimizing detergent selection—screening mild detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin that efficiently solubilize membranes while preserving protein structure; (2) Implementing stabilizing additives—incorporating glycerol (10-20%), specific lipids (cholesteryl hemisuccinate or physiologically relevant phospholipids), and osmolytes like trehalose throughout purification buffers; (3) Temperature control—maintaining samples at 4°C throughout all processing steps and minimizing freeze-thaw cycles; (4) Buffer optimization—using buffers that mimic physiological pH (typically 7.2-7.4) with stabilizing concentrations of salt (150-300 mM NaCl) and reducing agents (1-5 mM DTT or TCEP) to prevent disulfide-mediated aggregation.

Advanced approaches include: (5) Protein engineering—introducing thermostabilizing mutations or fusion partners like SUMO or MBP that enhance expression and solubility; (6) Nanodiscs or amphipols—transferring detergent-solubilized mscL into these systems which provide more native-like membrane environments; (7) Lipid cubic phase methods—particularly useful if crystallization is the end goal; and (8) Time optimization—minimizing the duration of each purification step and proceeding immediately to functional reconstitution to limit exposure to detergents.

A systematic approach would begin with expression screening of multiple constructs with different tags and fusion partners, followed by detergent screening using fluorescence-based thermostability assays (CPM or FSEC) to identify optimal solubilization conditions. Purification protocols should incorporate size exclusion chromatography as a final step not only for purification but as a critical quality control to verify monodispersity of the pentameric mscL assembly. Success can be monitored through functional assays including patch-clamp electrophysiology after reconstitution or liposome-based flux assays that directly assess channel activity.

What strategies can overcome the challenge of low expression yields when producing recombinant Y. pestis mscL?

Overcoming low expression yields of recombinant Y. pestis mscL requires a multi-faceted approach addressing factors at the genetic, cellular, and process levels. First, genetic optimization strategies include: (1) Codon optimization for the expression host, particularly important when expressing Y. pestis genes in E. coli due to different codon usage preferences; (2) Implementation of stronger promoters such as T7 or tac, combined with tightly regulated induction systems to prevent toxicity from basal expression; (3) Incorporation of fusion partners (MBP, SUMO, Mistic, or the highly-expressing GFP variant Superfolder GFP) that enhance membrane protein expression and provide convenient purification handles; and (4) Introduction of specific mutations that improve protein stability without affecting function, identified through directed evolution or computational design.

Second, expression host optimization includes: (5) Screening specialized E. coli strains designed for membrane protein expression (C41/C43, LEMO21, or Rosetta gami strains that provide additional tRNAs for rare codons); (6) Testing alternative expression hosts such as Lactococcus lactis or cell-free systems that may better accommodate Y. pestis membrane proteins; and (7) Co-expression of chaperones (GroEL/ES, DnaK/J) that assist with proper folding.

Third, process optimization encompasses: (8) Fine-tuning induction conditions—lowering temperature (16-25°C), reducing inducer concentration, and extending expression time; (9) Supplementing growth media with specific lipids or membrane-fluidizing agents; (10) Implementing high-density fermentation techniques to increase biomass; and (11) Optimizing cell disruption methods to maximize recovery from membrane fractions.

A systematic optimization workflow would begin with small-scale expression screening across multiple constructs and conditions, followed by fluorescence-based detection methods (GFP fusion or immunofluorescence) to rapidly assess expression levels before scaling up to production quantities. This comprehensive approach can typically improve yields by 5-10 fold over initial expression attempts.

How might single-molecule techniques advance our understanding of Y. pestis mscL gating mechanisms?

Single-molecule techniques offer unprecedented opportunities to elucidate Y. pestis mscL gating mechanisms by providing direct observations of conformational dynamics impossible with ensemble measurements. High-resolution approaches that would significantly advance the field include: (1) Single-molecule FRET (smFRET) with strategically placed fluorophore pairs on the mscL pentamer to track real-time conformational changes during gating, revealing intermediate states and their lifetimes; (2) Optical tweezers combined with fluorescence microscopy to apply precisely controlled tension to individual mscL channels while simultaneously monitoring their open/closed state; (3) Magnetic tweezers assays where magnetic beads attached to mscL-containing membranes allow application of defined forces while recording channel activity; and (4) High-speed atomic force microscopy (HS-AFM) to visualize structural rearrangements of mscL in native-like membrane environments with nanometer spatial resolution and sub-second temporal resolution.

More specialized techniques include: (5) Single-molecule patch-clamp fluorometry combining electrical recording with fluorescence detection to correlate conformational changes with functional states; (6) Fluorescence correlation spectroscopy (FCS) to measure diffusion properties that change with channel conformation; and (7) Single-particle cryo-electron microscopy to capture different conformational states of mscL under varying tension conditions.

To implement these approaches for Y. pestis mscL specifically, researchers would need to develop site-specific labeling strategies compatible with the pentameric structure, potentially using unnatural amino acid incorporation for precise fluorophore positioning. The resulting single-molecule data would reveal the sequence and timing of conformational changes during the gating process, the existence and stability of subconductance states, potential asymmetry in subunit movements, and the detailed energetics of the tension-sensing mechanism. These insights would be particularly valuable for understanding how Y. pestis mscL may have adapted to the unique osmotic challenges encountered during transitions between flea vectors and mammalian hosts .

What research approaches could elucidate the potential role of mscL in Y. pestis dormancy or persister cell formation?

Investigating mscL's role in Y. pestis dormancy or persister cell formation requires innovative research approaches spanning molecular genetics, single-cell analysis, and in vivo models. First, researchers should create reporter systems with fluorescent proteins under the control of the mscL promoter, combined with established dormancy markers, to visualize potential correlations between mscL expression and dormancy induction at the single-cell level. Second, dual-reporter strains could monitor mscL localization and activity simultaneously with metabolic status indicators (such as ATP levels or membrane potential) to establish temporal relationships between channel activation and metabolic dormancy.

Third, transcriptomic and proteomic profiling comparing wild-type and ΔmscL Y. pestis under dormancy-inducing conditions (nutrient limitation, antibiotic stress, temperature shifts) would identify downstream genetic networks linking mscL to persister formation. Fourth, microfluidic single-cell tracking systems would allow real-time observation of individual Y. pestis cells transitioning to dormancy, with simultaneous monitoring of mscL activity through tension-sensitive fluorescent reporters.

Fifth, in vitro dormancy models should be complemented with tissue-based systems that better recapitulate the in vivo environment, such as 3D macrophage infection models where Y. pestis naturally establishes persister populations. Sixth, animal infection models comparing persistence of wild-type versus mscL-modified strains would provide the ultimate validation of mscL's role in establishing long-term infection reservoirs. These studies should especially focus on lymph nodes, where Y. pestis forms buboes and potentially establishes persistent populations .

Finally, pharmacological approaches using mscL modulators (both activators and inhibitors) could provide interventional evidence of the channel's role in dormancy, potentially revealing new therapeutic strategies for eliminating persistent Y. pestis infections that might otherwise lead to recrudescent disease.

How could CRISPR-Cas9 technology be optimized for studying mscL function in Y. pestis?

Optimizing CRISPR-Cas9 technology for studying mscL function in Y. pestis requires addressing several unique challenges related to this pathogen's biology and biosafety requirements. A comprehensive approach would include: (1) Developing Y. pestis-optimized CRISPR components—customizing Cas9 codon usage, testing various promoters for optimal expression in Y. pestis (pPCP1, pMT1 native promoters versus heterologous promoters), and designing sgRNA scaffolds that function efficiently at both 28°C (flea temperature) and 37°C (mammalian host temperature) ; (2) Establishing efficient delivery methods—creating temperature-sensitive plasmids for transient Cas9 expression or employing conjugation-based approaches to introduce CRISPR components from non-pathogenic donors; (3) Enhancing homology-directed repair (HDR) efficiency—optimizing homology arm lengths (typically 500-1000bp for Y. pestis) and introducing multiple sgRNAs to increase cutting efficiency.

For mscL-specific modifications, researchers should: (4) Design precise editing strategies including complete gene deletion, point mutations at tension-sensing residues, insertion of epitope tags for tracking, and knockin of fluorescent reporters; (5) Implement scarless editing methods to avoid polar effects on adjacent genes; and (6) Develop inducible CRISPR systems (e.g., using anhydrotetracycline control) for temporal control of mscL disruption during specific infection stages.

Special considerations for Y. pestis include: (7) Testing CRISPR functionality across different strains (KIM, CO92) that may have strain-specific requirements; (8) Validating editing efficiency at different temperatures representing various stages of the Y. pestis lifecycle; and (9) Developing biosafety-compatible workflows that minimize aerosol generation during transformation procedures. The optimized CRISPR-Cas9 system would enable precise dissection of mscL function through creation of point mutations affecting specific aspects of channel function, domain swaps between Y. pestis and related species, and temporal control of mscL expression during different phases of infection.

How might structural insights from Y. pestis mscL inform the design of novel biosensors or tension-sensitive nanodevices?

Structural insights from Y. pestis mscL provide an exceptional blueprint for designing advanced biosensors and tension-sensitive nanodevices through several innovative approaches. First, engineered mscL-based biosensors can be developed by modifying the channel's tension sensitivity threshold through targeted mutations in the transmembrane domains. This creates customizable pressure sensors with precise activation parameters suitable for applications requiring detection of specific membrane tension values. Second, researchers can exploit mscL's natural pore expansion mechanism (from ~2 nm to ~30 nm diameter upon activation) to design controlled-release nanocontainers that discharge cargo in response to mechanical stimuli. These systems could be particularly valuable for targeted drug delivery applications where release is triggered by tissue-specific mechanical properties.

Third, hybrid bioelectronic interfaces can be created by reconstituting engineered mscL channels into supported lipid bilayers on conductive surfaces, creating mechanoelectrical transducers where tension-activated ion flux generates measurable electrical signals. Fourth, the pentameric structure of mscL offers a platform for multiplexed sensing by attaching different recognition elements to each subunit, enabling detection of multiple analytes simultaneously through tension-mediated gating.

Advanced applications include: (1) Cell-based biosensors where genetically modified cells expressing engineered Y. pestis mscL variants coupled to reporter systems provide readouts of tissue mechanics in vivo; (2) Environmental biosensors using reconstituted mscL in artificial membranes to detect membrane-active toxins or environmental contaminants that alter membrane properties; and (3) Biomimetic mechanotransduction devices that recreate the exquisite mechanical sensing properties of biological systems in synthetic contexts. The molecular architecture of Y. pestis mscL, evolved to respond to the specific mechanical challenges of host-pathogen transitions, offers unique design principles that may differ from the more commonly studied E. coli mscL, potentially providing novel properties for nanodevice applications.

What collaborations between microbiologists and computational biologists would most advance understanding of mscL dynamics in Y. pestis pathogenesis?

Productive collaborations between microbiologists and computational biologists to advance understanding of mscL dynamics in Y. pestis pathogenesis should focus on several key research intersections. First, integrative structural modeling combining experimental data (X-ray crystallography, cryo-EM, FRET) with advanced simulation techniques (molecular dynamics, elastic network models) would generate comprehensive models of Y. pestis mscL gating under conditions mimicking host-pathogen transitions. This collaboration would require microbiologists to provide high-quality protein samples and experimental constraints while computational biologists contribute expertise in simulation algorithms and high-performance computing resources.

Second, systems biology approaches linking mscL activity to broader bacterial physiology would benefit from joint expertise in transcriptomic/proteomic data generation by microbiologists and network analysis/mathematical modeling skills from computational scientists. This collaboration could illuminate how mscL-mediated osmotic sensing integrates with virulence regulation networks during infection. Third, machine learning approaches applied to high-throughput phenotypic data could identify non-obvious correlations between mscL genetic variants and infection outcomes, requiring microbiologists to generate systematic mutation libraries and infection data while computational partners develop appropriate predictive algorithms.

Fourth, multiscale modeling connecting molecular-level mscL dynamics to cellular-level osmotic regulation and ultimately to host-pathogen interaction would bridge across biological scales. This ambitious collaboration would integrate patch-clamp electrophysiology data, single-cell bacterial responses, and in vivo infection dynamics into cohesive computational frameworks. The most successful collaborations would establish continuous feedback loops where computational predictions drive experimental design and experimental results refine computational models. Specific joint projects might include developing tension-sensitive biosensors to track mscL activity during infection, creating genome-scale metabolic models incorporating mechanosensitive channel activity, and designing novel antimicrobials targeting Y. pestis mscL using in silico screening approaches validated through experimental testing.

How can insights from studying Y. pestis mscL contribute to our broader understanding of bacterial adaptation to extreme environments?

Insights from Y. pestis mscL research offer significant contributions to our understanding of bacterial adaptation to extreme environments through several conceptual frameworks. First, Y. pestis presents a unique model system for studying rapid adaptation across drastically different host environments—transitioning from the flea midgut (temperature ~28°C, relatively stable osmolarity) to mammalian tissues (temperature 37°C, variable osmolarity during infection progression) . The functional properties of Y. pestis mscL, including its tension sensitivity threshold and gating kinetics, likely reflect evolutionary adaptations to these specific environmental transitions.

Second, comparative analysis between Y. pestis mscL and homologs from closely related but environmentally distinct Yersinia species (Y. pseudotuberculosis, Y. enterocolitica) provides a natural experiment in how mechanosensitive channels adapt to different ecological niches . By identifying specific amino acid substitutions that correlate with environmental preferences, researchers can develop predictive models for how mechanosensation evolves in response to specific environmental challenges.

Third, Y. pestis mscL research contributes to understanding the molecular basis of bacterial dormancy and stress response, as mechanosensitive channels may serve as environmental sensors triggering downstream adaptation pathways. This connects to broader questions about how bacteria monitor their surroundings and adjust metabolic and structural properties accordingly. Fourth, Y. pestis's successful adaptation to both arthropod and mammalian hosts demonstrates how mechanosensing contributes to vector-borne pathogen life cycles, potentially revealing common principles applicable to other vector-transmitted bacteria.

Finally, the engineering principles revealed through Y. pestis mscL structure-function studies—how protein complexes can rapidly and reversibly convert mechanical force into conformational changes—inform biomimetic approaches to designing synthetic systems with similar capabilities. Such systems could have applications ranging from environmental monitoring to responsive materials designed for extreme conditions like space exploration or deep-sea environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.