Recombinant Yersinia pestis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yersinia pestis Lipoprotein Signal Peptidase (LspA)

Lipoprotein signal peptidase (LspA), a type II signal peptidase (SPaseII), is essential for bacterial lipoprotein processing. In Yersinia pestis—the causative agent of plague—LspA cleaves the signal peptide from prolipoproteins, enabling their maturation and integration into the outer membrane. Recombinant LspA refers to the enzyme produced through genetic engineering, typically in heterologous systems like Escherichia coli, for functional and structural studies.

Genetic Context

  • lspA in Y. pestis is part of the lipoprotein biosynthesis pathway, which includes genes like lgt (lipoprotein glycosyltransferase) and lnt (apolipoprotein N-acyltransferase) .

  • Unlike Myxococcus xanthus, which has four redundant lspA genes, Y. pestis retains a single lspA homolog, consistent with most Gram-negative bacteria .

Conserved Domains

  • SPaseII enzymes, including Y. pestis LspA, contain conserved residues critical for catalytic activity. For example, aspartic acid and histidine residues form the catalytic triad required for proteolytic cleavage .

  • Structural modeling based on homologs (e.g., E. coli LspA) predicts a transmembrane domain and a periplasmic catalytic site .

Complementation in Model Systems

  • In E. coli, deletion of native lspA is lethal, but survival can be restored by expressing heterologous lspA genes (e.g., from M. xanthus), demonstrating functional conservation .

  • Recombinant Y. pestis LspA likely shares this complementation ability, though direct experimental evidence remains limited.

Antibiotic Resistance Phenotypes

  • Overexpression of SPaseII homologs in E. coli confers resistance to antibiotics like TA (myxovirescin) and globomycin, which target lipoprotein processing .

  • Hypothetically, recombinant Y. pestis LspA could exhibit similar resistance mechanisms, potentially influencing bacterial survival under antibiotic pressure.

Lipoprotein Processing and Virulence

  • Mature lipoproteins in Y. pestis contribute to immune evasion (e.g., Braun lipoprotein Lpp) and stress adaptation .

  • LspA-processed lipoproteins may interact with Toll-like receptor 2 (TLR2), triggering proinflammatory responses, though Y. pestis tetra-acylated lipid A (LPS) dampens TLR4 signaling .

Temperature-Dependent Regulation

  • Y. pestis lipid A structure shifts with temperature (27°C vs. 37°C), altering LPS immunogenicity . While LspA activity is not directly temperature-regulated, lipoprotein abundance may vary under host conditions, affecting virulence.

Expression Systems

  • Cloning: Y. pestis lspA can be cloned into vectors like pBAD30 under inducible promoters (e.g., arabinose) for controlled expression .

  • Purification: His-tagged recombinant LspA is typically purified via nickel-affinity chromatography, with yields dependent on induction conditions .

Functional Assays

AssayMethodKey Findings
ComplementationRescue of E. coli ΔlspA lethalityConfirms enzymatic activity
Antibiotic SensitivityDisk diffusion with TA/globomycinMeasures resistance conferred by LspA
Proteolytic ActivityFluorescent substrate cleavageQuantifies signal peptide processing efficiency

Research Gaps and Future Directions

  • Structural Characterization: No crystal structure of Y. pestis LspA exists; homology modeling is needed to guide inhibitor design.

  • Pathogenesis Link: Direct evidence linking LspA activity to Y. pestis virulence (e.g., animal models) is lacking.

  • Therapeutic Potential: SPaseII inhibitors could synergize with existing antibiotics, but Y. pestis-specific drug screens are pending .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag type.
Synonyms
lspA; YPDSF_3156; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
lspA
Target Protein Sequence
MNKPICSTGLRWLWLAVVVVILDISSKQWVMAHFALYESVPLIPFFNLTYAQNFGAAFSF LADKSGWQRWFFAGIAIGISVVLMVMMYRSTAKQRLINCAYALIIGGALGNLYDRLVHGA VNDFLDFYINNWHFPTFNLADVAICIGAALVIFEGFLSPVEKNAVNNDE
Uniprot No.

Target Background

Function
This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is lipoprotein signal peptidase (lspA) and what is its role in Yersinia pestis?

Lipoprotein signal peptidase (lspA) in Yersinia pestis is an enzyme that cleaves the signal peptide from prolipoproteins, a critical step in lipoprotein maturation. While the specific putative virulence or resistance function of lspA in Y. pestis remains categorized as "unknown" in current databases, it is essential for processing lipoproteins that may contribute to bacterial survival and pathogenicity . The gene is identified as YP_3704 with accession number NP_994975.1 in Y. pestis strain 91001. Methodologically, researchers can determine lspA function through targeted gene knockout studies followed by phenotypic characterization, complementation assays, and virulence testing in appropriate animal models.

How does lspA processing relate to Y. pestis evolution from Y. pseudotuberculosis?

Y. pestis has evolved from Y. pseudotuberculosis within the last 2,600 to 28,000 years, with several key genetic modifications contributing to its increased virulence and different lifestyle . A distinguishing characteristic between these closely related species is that Y. pseudotuberculosis possesses an O-antigen of lipopolysaccharide (LPS), while Y. pestis has lost this O-antigen during evolution and exposes its core LPS . The processing of lipoproteins by lspA may have adapted alongside these changes, potentially contributing to differences in membrane structure and host-pathogen interactions. To investigate these evolutionary relationships, researchers should employ comparative genomics and transcriptomics of lspA between the two species, coupled with functional assays examining lipoprotein processing efficiency.

What are the structural characteristics of Y. pestis lspA compared to other bacterial species?

Y. pestis lspA belongs to the family of type II signal peptidases, which are typically small membrane proteins with multiple transmembrane domains. Although specific structural data for Y. pestis lspA is limited, the high degree of homology between proteins involved in similar pathways across Yersinia species (98-100%) suggests conservation of structure and function . For experimental characterization, researchers should employ membrane protein crystallization techniques, coupled with circular dichroism spectroscopy to analyze secondary structure elements, and site-directed mutagenesis to identify catalytic residues.

What expression systems are most effective for producing recombinant Y. pestis lspA?

For recombinant expression of Y. pestis lspA, considering its nature as a membrane protein, researchers should test multiple expression systems. E. coli BL21(DE3) with pET vector systems containing a fusion tag (such as His6) offers a starting point, but alternative systems like Pichia pastoris may provide better membrane protein folding. Expression protocols should include optimization of induction conditions (temperature, IPTG concentration, induction time) and membrane protein extraction methods using mild detergents. Success rates can be improved by using specialized strains like C41(DE3) or C43(DE3) designed for membrane protein expression, coupled with fusion partners that enhance solubility.

How can researchers optimize purification of active recombinant lspA?

Purification of active recombinant lspA presents challenges due to its membrane-embedded nature. A methodological approach should include:

  • Solubilization screening with various detergents (DDM, LDAO, C12E8)

  • Affinity chromatography using His-tag or other fusion tags

  • Size exclusion chromatography for further purification

  • Activity assays using synthetic peptide substrates

Researchers should be aware that maintenance of the native conformation is critical, and therefore gentler extraction methods and stabilizing agents may be necessary. The activity of purified lspA can be verified using fluorogenic peptide substrates that mimic natural prolipoprotein cleavage sites.

What are the key considerations for designing functional assays for recombinant lspA?

When designing functional assays for recombinant lspA, researchers should consider:

  • Substrate specificity - using synthetic peptides based on Y. pestis prolipoprotein sequences

  • Enzyme kinetics parameters (Km, Vmax, kcat)

  • Inhibition studies with known signal peptidase inhibitors

  • pH and temperature optima determination

A robust assay should incorporate fluorescence-based detection methods for real-time monitoring of peptide cleavage, allowing for high-throughput screening of conditions or inhibitors. Controls should include heat-inactivated enzyme and catalytic site mutants to confirm specificity of the observed activity.

How does lspA activity contribute to Y. pestis virulence and dissemination?

While direct evidence linking lspA to Y. pestis virulence is limited in the provided search results, inferences can be made based on the role of processed lipoproteins in pathogenesis. Y. pestis utilizes its core LPS to interact with SIGNR1 (CD209b), a C-type lectin receptor on antigen presenting cells (APCs), leading to bacterial dissemination to lymph nodes, spleen, and liver . LspA-processed lipoproteins may contribute to this process by maintaining membrane integrity or directly participating in host-pathogen interactions. To investigate this connection, researchers should conduct in vivo experiments with lspA-deficient mutants, assessing bacterial dissemination rates and immune response activation compared to wild-type strains.

What is the relationship between lspA function and Y. pestis adaptation to different host environments?

Y. pestis experiences distinct environments during its lifecycle between fleas and mammals, requiring significant adaptations . Laboratory adaptation studies have shown that Y. pestis undergoes considerable parallel evolution when adapting to new environments, with changes in virulence and nutrient acquisition systems . LspA may contribute to these adaptations by processing different sets of lipoproteins depending on the host environment. To study this phenomenon, researchers should examine lspA expression and activity under conditions mimicking different host environments (37°C vs. 26°C, varying pH and nutrient conditions) and perform comparative proteomics to identify differentially processed lipoproteins.

How might temperature-dependent regulation affect lspA activity in Y. pestis?

Y. pestis demonstrates temperature-dependent variations in LPS structure that are genetically controlled and play roles in plague pathogenesis . Similar temperature-dependent regulation might affect lspA expression and activity, potentially contributing to adaptation between the flea vector (lower temperature) and mammalian host (higher temperature). For experimental validation, researchers should employ qRT-PCR and Western blotting to assess lspA expression at different temperatures, combined with enzyme activity assays under various temperature conditions to determine if functional changes occur during temperature shifts that mimic host transitions.

Can recombinant lspA be utilized as a target for novel antimicrobial development?

Given the essential role of lipoprotein processing in bacterial survival, lspA represents a potential target for antimicrobial development. Researchers investigating this application should:

  • Establish high-throughput screening assays for inhibitor identification

  • Perform structure-based drug design if structural data becomes available

  • Validate hits using both biochemical assays and bacterial growth/survival studies

  • Assess specificity by testing against mammalian peptidases

The efficacy of potential inhibitors should be evaluated in both laboratory culture conditions and infection models, with particular attention to pharmacokinetic properties and toxicity profiles.

How can researchers address the challenges of lspA crystallization for structural studies?

Membrane protein crystallization presents significant challenges. For lspA structural studies, researchers should consider:

  • Screening multiple detergents and lipid compositions to maintain native conformation

  • Utilizing lipidic cubic phase crystallization techniques

  • Employing fusion partners known to facilitate membrane protein crystallization (e.g., T4 lysozyme)

  • Considering alternative structural techniques such as cryo-electron microscopy

Success rates can be improved by using truncated constructs that maintain the catalytic domain while removing flexible regions, and by intensive screening of crystallization conditions using automated systems.

What approaches can be used to study lspA interactions with substrate lipoproteins in Y. pestis?

To characterize lspA-substrate interactions, researchers should employ:

  • Bacterial two-hybrid or pull-down assays with tagged lspA

  • Chemical cross-linking followed by mass spectrometry

  • Surface plasmon resonance (SPR) with immobilized lspA and peptide substrates

  • Computational modeling of enzyme-substrate interactions

Advanced techniques like hydrogen-deuterium exchange mass spectrometry can provide insights into the dynamic interactions between lspA and its substrates, revealing conformational changes that occur during the catalytic cycle.

What genomic modifications to lspA occurred during Y. pestis laboratory adaptation?

Laboratory adaptation of Y. pestis involves systems-level changes in metabolism and physiology . While specific lspA mutations were not reported in the parallel serial passage experiment described in the search results, researchers interested in laboratory adaptation should carefully monitor lspA sequence and expression changes during extended laboratory culture. Whole genome sequencing combined with proteomics approaches, as described in study , provides a powerful methodology for tracking evolutionary changes. Researchers should design experiments that compare lspA sequence and expression between wild isolates and laboratory-adapted strains after defined passage numbers.

How does horizontal gene transfer influence lspA conservation and diversity across Yersinia species?

While lspA appears highly conserved within Yersinia species, the potential for horizontal gene transfer influencing its evolution remains an important research question. To address this, researchers should:

  • Perform comprehensive phylogenetic analyses of lspA across diverse bacterial species

  • Calculate dN/dS ratios to identify selection pressures

  • Identify genomic islands or mobile genetic elements associated with lspA

  • Compare codon usage patterns for evidence of recent horizontal transfer

These analyses should be complemented with functional studies comparing lspA activity across species to determine if sequence divergence correlates with functional specialization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.