Recombinant Yersinia pestis Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your usage.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nqrE; YPDSF_2863; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
nqrE
Target Protein Sequence
MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVY NLVLRDGALVEGVDLSFLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNC AIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGIREKMKYANVPAGLQGLGITF ISTGLMALGFMSFAGVNL
Uniprot No.

Target Background

Function
The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinol through two sequential reactions, coupled with the transport of Na(+) ions from the cytoplasm to the periplasm. NqrA to NqrE are likely involved in the second step, the conversion of ubisemiquinone to ubiquinol.
Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Na(+)-translocating NADH-quinone reductase subunit E in Yersinia pestis?

NqrE is a critical subunit of the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) complex, which catalyzes electron transfer from NADH to ubiquinone coupled with Na+ translocation across the bacterial membrane. The full-length Y. pestis bv. Antiqua NqrE protein consists of 198 amino acids with the sequence: "MEHYISLLVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGIAVTVVLGISVPANNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAAIVQVLEMILDRYFPALYNALGIFLPLITVNCAIFGGVSFMAQRDYNFPESIVYGFGSGMGWMLAIVALAGIREKMKYANVPAGLQGLGITFISTGLMALGFMSFAGVNL" .

NqrE is a transmembrane protein that forms part of a unique (Cys)4[Fe] center with the NqrD subunit, which is essential for electron transfer within the complex . This iron-sulfur center represents a critical functional component of the Na+-NQR respiratory system.

Why is Na+-NQR significant in bacterial pathogens including Y. pestis?

Na+-NQR is a unique primary Na+ pump believed to enhance the vitality of many bacteria, including important pathogens such as Vibrio cholerae, Vibrio parahaemolyticus, Haemophilus influenzae, Neisseria gonorrhoeae, Pasteurella multocida, Porphyromonas gingivalis, Enterobacter aerogenes, and Yersinia pestis . As a primary sodium pump, it contributes to the establishment of the sodium motive force that drives various cellular processes.

The uniqueness of Na+-NQR to bacteria and its absence in mammals makes it a promising drug target for combating bacterial infections . Understanding the function of NqrE within this complex could lead to the development of novel antibiotics that specifically target pathogenic bacteria containing this respiratory enzyme.

What are the key biochemical properties of recombinant Y. pestis NqrE protein?

Recombinant Y. pestis NqrE is typically produced as a full-length protein (198 amino acids) with an N-terminal His-tag for purification purposes . The protein has the following specifications:

PropertySpecification
SpeciesYersinia pestis bv. Antiqua
Expression SystemE. coli
TagHis
Protein LengthFull Length (1-198)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

The His-tagged recombinant protein maintains its functional properties when properly incorporated into the Na+-NQR complex, though proper assembly requires additional maturation factors .

What are the optimal conditions for reconstituting and storing recombinant Y. pestis NqrE protein?

For optimal reconstitution and storage of recombinant NqrE protein, follow these methodological guidelines:

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • Prepare multiple aliquots to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Critical considerations:

    • Avoid repeated freezing and thawing which can compromise protein integrity

    • The storage buffer (Tris/PBS-based with 6% Trehalose, pH 8.0) helps maintain protein stability

How can researchers measure the enzymatic activity of Na+-NQR containing the NqrE subunit?

Measuring the enzymatic activity of Na+-NQR requires specific assays that can distinguish its activity from other NADH dehydrogenases. The following methodological approaches are recommended:

  • NADH/dNADH oxidation assay:

    • Measure spectrophotometrically at 340 nm

    • Use an extinction coefficient (ε340) of 6.22 mM−1 cm−1 for NADH/dNADH quantitation

    • Prepare reaction medium containing 20 mM HEPES-Tris, 5 mM MgSO4, and 50 mM KCl (pH 8.0)

  • Quinone reductase activity:

    • Measure the sodium-stimulated component of dNADH oxidation

    • Compare activity with and without added Na+ to identify Na+-dependent activity

    • Include HQNO (2-n-heptyl-4-hydroxyquinoline N-oxide) as a specific inhibitor to confirm Na+-NQR activity

  • dNADH:menadione oxidoreductase activity:

    • Supplement the reaction medium with 50 μM menadione

    • This assay specifically measures the NADH dehydrogenase activity of Na+-NQR

Representative activity values obtained from different recombinant constructs are shown in Table 1:

Table 1. Na+-NQR Activities in Membrane Vesicles

PlasmidNa+-stimulated dNADH oxidase (nmol·min−1·mg−1)dNADH:menadione oxidoreductase (nmol·min−1·mg−1)NADH oxidase (nmol·min−1·mg−1)
pNQ<1240 ± 70830 ± 120
pNQ_AE3 ± 1260 ± 40770 ± 90
pNQ_AE_NqrM65 ± 8310 ± 60850 ± 200
pNQ_NqrM<1220 ± 60790 ± 50
pBAD (control)<15 ± 2750 ± 80

Note: All reported values are means of three measurements ± standard deviation (SD) .

What expression systems and maturation factors are required for producing functional Na+-NQR containing NqrE?

Expression of functional Na+-NQR requires not only the structural genes of the complex but also specific maturation factors. The methodological approach should include:

  • Expression system selection:

    • E. coli is a suitable host for heterologous expression

    • Expression of the nqr operon (nqrA-F) alone in E. coli produces an incomplete complex with no Na+-dependent activity

  • Required maturation factors:

    • ApbE: Flavin transferase that catalyzes covalent attachment of FMN residues

    • NqrM: Required for proper assembly of the complex, particularly for the formation of the (Cys)4[Fe] center between NqrD and NqrE subunits

  • Optimal expression conditions:

    • Co-expression of nqr operon with both ApbE and NqrM is essential for producing functional Na+-NQR

    • Use of inducible promoters (such as the araBAD promoter) allows controlled expression

    • Varying inducer concentration can optimize the ratio of maturation factors to structural proteins

Research has demonstrated that only when all three components (nqr operon, ApbE, and NqrM) are co-expressed can fully functional Na+-NQR be produced with Na+-stimulated, HQNO-inhibited dNADH oxidase activity .

What is the role of the (Cys)4[Fe] center in the interaction between NqrD and NqrE subunits?

The (Cys)4[Fe] center represents a crucial structural and functional element in the Na+-NQR complex, particularly in the context of NqrD and NqrE subunit interaction:

  • Structural significance:

    • Forms a bridging element between NqrD and NqrE subunits

    • Creates a unique iron-binding site coordinated by four cysteine residues

    • Essential for proper assembly of the complete Na+-NQR complex

  • Functional importance:

    • Participates in the electron transfer pathway within the Na+-NQR complex

    • The iron center likely serves as an electron carrier during the NADH:quinone oxidoreductase reaction

    • Disruption of this center prevents Na+-dependent quinone reductase activity

  • Maturation process:

    • NqrM protein is involved in the delivery of Fe to form this center

    • Specific conserved cysteine residues in NqrM (particularly Cys33 in V. harveyi) are critical for this process

    • Mutation of Cys33 to Ser completely prevents Na+-NQR maturation

Research on incomplete Na+-NQR complexes isolated from NqrM-deficient strains has shown that they lack several subunits, including potentially NqrE, demonstrating the essential role of this iron center in complex stability .

How do the specific amino acid residues in NqrE contribute to Na+ translocation?

While the search results don't directly address the specific amino acid residues in NqrE involved in Na+ translocation, several methodological approaches can be used to investigate this question:

  • Structural analysis:

    • The transmembrane regions of NqrE likely contain residues involved in Na+ binding and transport

    • The hydrophobic regions in the amino acid sequence suggest multiple transmembrane helices that could form part of a Na+ channel

  • Mutagenesis studies:

    • Site-directed mutagenesis of conserved charged or polar residues within transmembrane regions can identify those involved in Na+ coordination

    • Substitution of key residues would likely affect Na+ translocation without necessarily disrupting electron transfer

  • Comparative approaches:

    • Analysis of NqrE sequences across Na+-NQR-containing bacteria could identify highly conserved residues potentially involved in Na+ translocation

    • Comparison with other Na+ transporters might reveal common structural motifs

Understanding the precise mechanism of Na+ translocation by the Na+-NQR complex remains an active area of research, with NqrE likely playing a key role in this process given its transmembrane nature and position within the complex.

What are the metabolic consequences of Na+-NQR dysfunction in bacterial pathogens?

The metabolic impact of Na+-NQR dysfunction extends beyond simple respiratory defects, affecting multiple aspects of bacterial physiology:

  • Energy metabolism alterations:

    • Decreased Na+ motive force affects energy-dependent processes

    • Potential compensatory upregulation of alternative respiratory enzymes

    • Altered electron flow through the respiratory chain can affect ATP production

  • Specific metabolic pathway changes:

    • Upregulation of genes encoding lysine decarboxylase (cadA) and lysine/cadaverine antiporter (cadB)

    • Increased reductive pathway of the TCA cycle

    • Decreased purine metabolism

    • Down-regulation of sialic acid catabolism genes

  • Physiological adaptations:

    • Bacteria can compensate for Na+-NQR loss through alternative Na+ pumps

    • Metabolic rewiring occurs to maintain cellular homeostasis

    • The precise adaptation mechanisms may vary between different bacterial species

Studies in Vibrio cholerae have shown that while deletion of the entire nqr operon causes multiple metabolic defects, it doesn't affect all Na+ pumping-related phenotypes, suggesting compensatory mechanisms exist . These findings provide insight into potential metabolic vulnerabilities that could be targeted in Y. pestis and other pathogens containing Na+-NQR.

Why might recombinant NqrE fail to integrate properly into the Na+-NQR complex?

Failure of recombinant NqrE to properly integrate into the Na+-NQR complex can occur for several methodological reasons:

  • Maturation factor deficiencies:

    • Absence of ApbE, which catalyzes FMN attachment to specific subunits

    • Lack of NqrM, which is essential for Fe delivery to the (Cys)4[Fe] center between NqrD and NqrE

    • Without both factors, full assembly fails even when all structural genes are expressed

  • Protein folding and modification issues:

    • Improper membrane insertion due to overexpression or incorrect folding

    • Insufficient post-translational modifications

    • Tag interference (His-tag may occasionally disrupt protein-protein interactions)

  • Expression system limitations:

    • Host strain incompatibilities (e.g., codon usage differences)

    • Improper membrane composition in heterologous hosts

    • Competing endogenous proteins that may sequester cofactors

Research has demonstrated that isolation of Na+-NQR from NqrM-deficient strains results in complexes lacking several subunits and exhibiting no Na+-stimulated quinone reductase activity, highlighting the critical role of proper assembly factors .

What methods are available for assessing the structural integrity of purified recombinant NqrE?

Multiple analytical techniques can be employed to assess the structural integrity of purified recombinant NqrE:

  • Primary purity assessment:

    • SDS-PAGE analysis to confirm >90% purity and expected molecular weight (~22 kDa for His-tagged NqrE)

    • Western blotting with anti-His antibodies to verify full-length protein presence

  • Structural analysis techniques:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure elements

    • Limited proteolysis to assess folding state and domain organization

    • Blue native PAGE to examine native complex formation when combined with other subunits

  • Functional validation:

    • Reconstitution with other Na+-NQR subunits to test complex formation

    • Activity assays to confirm functional integration (Na+-stimulated, HQNO-sensitive dNADH oxidase activity)

    • Binding assays with known interaction partners (e.g., NqrD)

When examining potentially incomplete complexes, comparison with properly assembled Na+-NQR is essential. The yield of incomplete Na+-NQR complex from NqrM-deficient strains has been reported to be 13-fold lower than from wild-type strains, providing a quantitative benchmark for assembly efficiency .

What quality control measures should be implemented when working with recombinant NqrE for functional studies?

To ensure reliable results when working with recombinant NqrE in functional studies, implement these methodological quality control measures:

  • Protein quality verification:

    • Confirm protein purity (>90%) via SDS-PAGE

    • Verify protein concentration using validated methods (Bradford/BCA assay)

    • Assess protein stability through thermal shift assays or limited proteolysis

  • Functional controls:

    • Include positive controls (known functional Na+-NQR) in activity assays

    • Utilize negative controls (e.g., denatured protein or known inactive mutants)

    • Perform Na+-dependency tests to confirm specificity of activity

  • Experimental validation:

    • Verify reproducibility across multiple protein preparations

    • Test activity across different assay conditions (pH, temperature, ionic strength)

    • Compare activity with literature values (see Table 1 for reference values)

  • Storage and handling precautions:

    • Maintain strict aliquoting protocols to avoid freeze-thaw damage

    • Store at recommended temperatures (-20°C/-80°C for long-term; 4°C for up to one week for working solutions)

    • Include stabilizing agents (e.g., glycerol at 5-50%) in storage buffers

Implementing these quality control measures will help ensure that experimental results accurately reflect the true properties and functions of recombinant NqrE within the Na+-NQR complex.

How might structural information about NqrE contribute to rational drug design targeting Y. pestis Na+-NQR?

Structural analysis of NqrE presents significant opportunities for rational drug design against Y. pestis:

  • Structure-based drug discovery approach:

    • High-resolution structural data would enable identification of druggable pockets within NqrE

    • Computational docking studies could screen for compounds that specifically bind to these sites

    • Fragment-based approaches might identify building blocks for novel inhibitors

  • Targeting critical functional regions:

    • The (Cys)4[Fe] center between NqrD and NqrE represents a unique target absent in mammalian systems

    • Compounds disrupting the formation or function of this center could selectively inhibit bacterial growth

    • Targeting the interface between NqrE and other subunits could prevent complex assembly

  • Comparative structural biology:

    • Identifying structural differences between Y. pestis NqrE and related proteins in other pathogens could enable development of species-specific inhibitors

    • Understanding conserved regions across bacterial species might lead to broad-spectrum antibiotics targeting Na+-NQR

The unique nature of Na+-NQR to bacteria and its importance for pathogen viability make it an attractive drug target that could lead to novel antibiotics with minimal host toxicity .

What role might NqrE play in bacterial adaptation to environmental stresses?

The Na+-NQR complex containing NqrE likely contributes to bacterial adaptation to various environmental stresses:

  • pH homeostasis:

    • Na+ extrusion by Na+-NQR could help maintain intracellular pH during acid stress

    • Studies in Vibrio cholerae have shown that Na+-NQR deletion affects expression of acid stress response genes like cadA and cadB

  • Osmotic stress response:

    • Na+ cycling across the membrane contributes to osmotic balance

    • The Na+ gradient generated by Na+-NQR may help bacteria adapt to changing salt concentrations in their environment

  • Metabolic flexibility:

    • Na+-NQR provides an alternative to proton-pumping respiratory complexes

    • This respiratory flexibility may allow bacteria to adapt to environments with varying oxygen levels or carbon sources

  • Host colonization:

    • The contribution of Na+-NQR to bacterial energy metabolism may be particularly important during host infection

    • Environmental conditions in the host (e.g., nutrient availability, immune response) may influence Na+-NQR activity and expression

Further research into how Y. pestis regulates Na+-NQR expression and activity under different environmental conditions would provide valuable insights into bacterial adaptation mechanisms.

How do the properties of Y. pestis NqrE compare with homologous proteins in other pathogenic bacteria?

Comparative analysis of NqrE across different pathogenic bacteria reveals important insights:

  • Sequence conservation and divergence:

    • Core functional regions of NqrE are likely conserved across species

    • Transmembrane regions typically show higher conservation than soluble domains

    • Species-specific variations may reflect adaptation to particular ecological niches

  • Functional differences:

    • While the core function of electron transfer coupled to Na+ translocation is conserved, kinetic parameters may vary

    • Different dependency on Na+ concentration may reflect adaptation to different environmental sodium levels

    • Interaction with quinones may vary based on the predominant quinone species in each bacterium

  • Differential importance for pathogenesis:

    • In Vibrio cholerae, Na+-NQR deletion affects multiple metabolic pathways

    • The impact of Na+-NQR dysfunction likely varies between obligate pathogens like Y. pestis and facultative pathogens

    • The contribution to virulence may depend on the specific infection cycle of each pathogen

Comparative studies across pathogenic bacteria could identify both conserved targets for broad-spectrum antibiotics and species-specific vulnerabilities that could be exploited for targeted therapies against particular pathogens like Y. pestis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.