Recombinant Yersinia pestis NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Function and Importance

The NDH-1 complex, which includes nuoA, is essential for energy production via oxidative phosphorylation in bacteria . It oxidizes NADH and reduces quinone, with the concomitant translocation of protons .

Key functions:

Role in Virulence

The NADH-quinone oxidoreductase has been linked to the virulence of certain bacterial pathogens . For example, in Vibrio cholerae, the Na+-NQR, a type of NADH-quinone oxidoreductase, affects virulence . It has been identified as a source of reactive oxygen species (ROS) in vivo, which can participate in the regulated expression of virulence factors during the transition from aerobic to microaerophilic (intestinal) habitats .

V. cholerae ΔoxyR is hypersensitive to overexpression of Na+-NQR, indicating that ROS formed by the Na+-NQR are detoxified in the V. cholerae reference strain but are harmful to the oxyR deletion strain .

nuoA in Sodium Ion Translocation

The bacterial respiratory chain contains NADH:quinone oxidoreductases (NDH) that catalyze the oxidation of NADH by quinones . Some bacteria may also contain NDH-2, an NADH:quinone oxidoreductase that is not involved in energy transduction .

  • Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) is a respiratory sodium ion pump that produces ROS in vivo .

  • Deletion of nqr genes results in a mutant lacking Na+-NQR .

NqrM and Na+-NQR Complex

NqrM is a protein required for the maturation of bacterial Na+-NQR . Inactivation of NqrM prevents the assembly of a complete Na+-NQR complex .

Key findings regarding NqrM:

  • NqrM is essential for the production of V. harveyi Na+-NQR capable of quinone reduction in E. coli .

  • NqrM does not represent a previously unrecognized Na+-NQR subunit .

  • Cys/Ser substitutions in NqrM result in either zero or very low quinone reductase activity by Na+-NQR .

Table 2. Activity in membrane vesicles

PlasmidNa+-stimulated dNADH oxidasedNADH:menadione oxidoreductaseNADH oxidase
pNQ<1240 ± 70830 ± 120
pNQ_AE3 ± 1260 ± 40770 ± 90
pNQ_AE_NqrM65 ± 8310 ± 60850 ± 200
pNQ_NqrM<1220 ± 60790 ± 50
pBAD<15 ± 2750 ± 80

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
nuoA; YPDSF_1965; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
nuoA
Target Protein Sequence
MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSA RMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAAIFILVLLAGLFYLVRI GALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this species, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of NADH-quinone oxidoreductase subunit A (nuoA) in Yersinia pestis metabolism?

    NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of the NADH dehydrogenase I complex (NDH-1) in Y. pestis, functioning with EC number 1.6.99.5. This membrane-associated protein participates in the respiratory electron transport chain, coupling the transfer of electrons from NADH to quinones with proton translocation across the membrane. As Y. pestis is classified as a facultative anaerobe (able to grow with or without free oxygen), nuoA plays an essential role in energy metabolism under aerobic conditions . The protein consists of 166 amino acids and contains multiple membrane-spanning domains typical of respiratory complex subunits .

  • How is recombinant Y. pestis nuoA typically expressed and purified for research applications?

    Recombinant Y. pestis nuoA is predominantly expressed using E. coli expression systems with N-terminal His-tag fusion for purification purposes . The general methodology involves:

    Expression StageMethodology
    Vector ConstructionCloning full-length nuoA (1-166 aa) into expression vectors like pET28a
    Expression HostE. coli strains optimized for membrane protein expression
    PurificationNi-NTA affinity chromatography targeting the His-tag
    Storage FormTypically lyophilized with stabilizers (6% trehalose) in Tris/PBS buffer at pH 8.0
    ReconstitutionRehydration in deionized water to 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage

    Working aliquots should be stored at 4°C for up to one week, while long-term storage requires -20°C/-80°C conditions with minimal freeze-thaw cycles .

Advanced Research Questions

  • How can omics approaches be applied to investigate nuoA's role in Y. pestis pathogenesis?

    Multiple omics strategies can be employed to elucidate nuoA's function in Y. pestis virulence:

    Omics ApproachApplication to nuoA ResearchMethodology
    GenomicsEvolutionary analysis of nuoA conservation across Yersinia speciesComparative genomic analysis with tools available in Yersiniomics platform
    TranscriptomicsExpression patterns under different infection conditionsRNA-Seq analysis of nuoA expression during host interaction
    ProteomicsProtein-protein interaction networks involving nuoAMass spectrometry-based interactome analysis
    MetabolomicsImpact of nuoA mutations on bacterial metabolismMetabolic profiling of wild-type vs. nuoA mutants

    The Yersiniomics platform provides a centralized database gathering 200 genomic, 317 transcriptomic, and 62 proteomic datasets that can facilitate multi-omics integration for nuoA functional characterization . This integrated approach is particularly valuable since Y. pestis pathogenicity involves complex regulatory networks where respiratory components may play both metabolic and regulatory roles.

  • What methodologies can be used to investigate potential contributions of nuoA to Y. pestis virulence?

    To determine if nuoA contributes to Y. pestis virulence, several experimental approaches should be considered:

    1. Targeted gene knockout: Generate ΔnuoA mutants using homologous recombination techniques similar to those used for other Y. pestis genes .

    2. Virulence assessment in animal models: Compare wild-type and ΔnuoA mutant strains in established mouse models of bubonic and pneumonic plague .

    3. Transcriptional response analysis: Evaluate how nuoA deletion affects expression of known virulence factors like F1 and LcrV under infection-relevant conditions .

    4. Metabolic profiling: Assess how nuoA disruption impacts bacterial survival under various environmental stresses encountered during infection.

    5. Comparative analysis with related species: Examine functional differences in nuoA between Y. pestis and its evolutionary ancestor Y. pseudotuberculosis to identify adaptations related to plague virulence .

    Recent studies on Y. pestis negative selection provide methodological templates that could be applied to nuoA functional analysis .

  • How might nuoA function in the context of Y. pestis evolution from Y. pseudotuberculosis?

    Y. pestis evolved from Y. pseudotuberculosis within the past 20,000 years , acquiring specific adaptations that enabled its distinctive life cycle and virulence profile. Analysis of nuoA in this evolutionary context should consider:

    1. Sequence conservation analysis between Y. pestis and Y. pseudotuberculosis nuoA orthologs

    2. Functional comparison of respiratory metabolism between species under flea vector versus mammalian host conditions

    3. Assessment of selection pressure on nuoA during Y. pestis evolution (positive, negative, or neutral)

    4. Examination of nuoA expression patterns in different Y. pestis biovars and lineages associated with historical plague pandemics

    Evolutionary studies have identified other genes under negative selection during Y. pestis evolution that affected biofilm formation and vector adaptation . Similar approaches could reveal whether nuoA has undergone functional modifications contributing to Y. pestis' unique pathogenicity profile.

  • What is the potential significance of studying nuoA in the context of Y. pestis strain diversity?

    Y. pestis exhibits significant strain diversity associated with different geographical foci and historical plague epidemics . Research on nuoA across this diversity spectrum could:

    1. Identify strain-specific variations in nuoA sequence or expression that correlate with virulence differences

    2. Examine nuoA conservation across ancient and modern strains, including those from the three major plague pandemics:

      • Justinian plague (541-750/767 CE)

      • Black Death pandemic (14th century)

      • Modern pandemic (late 19th-early 20th century)

    3. Compare respiratory metabolism adaptations in strains from different geographical plague foci

    4. Assess whether nuoA function varies between strains causing different plague manifestations (bubonic vs. pneumonic)

    Recent genomic characterization of Y. pestis strains from the 2017 Madagascar pneumonic plague outbreak demonstrated how multiple lineages can cause simultaneous epidemics , highlighting the importance of studying metabolic proteins like nuoA across diverse strains.

  • How can protein interaction studies of nuoA contribute to understanding Y. pestis pathogenesis?

    Protein interaction studies focused on nuoA could reveal unexpected connections between metabolism and virulence in Y. pestis:

    1. Interactome analysis: Identify nuoA protein-protein interactions using pull-down assays coupled with mass spectrometry

    2. Bacterial two-hybrid screening: Discover potential regulatory interactions between nuoA and virulence-associated proteins

    3. Protein localization studies: Determine whether nuoA localizes exclusively to the membrane or forms additional associations during infection

    4. Temporal interaction dynamics: Examine how nuoA interactions change under various environmental conditions relevant to the plague transmission cycle

    Omics strategies previously applied to Y. pestis virulence research provide methodological frameworks that could be extended to nuoA-specific interaction studies . These approaches could reveal whether nuoA functions beyond its canonical role in respiration during host-pathogen interactions.

Research Applications

  • Could nuoA potentially serve as a novel target for antimicrobial development against Y. pestis?

    While F1 and LcrV antigens have been the primary focus of plague vaccine development , respiratory chain components like nuoA offer potential alternative targets for therapeutic intervention:

    1. Target validation: Assess nuoA essentiality for Y. pestis survival under various conditions using conditional mutants

    2. Compound screening: Develop high-throughput assays to identify inhibitors specific to Y. pestis NDH-1 complex

    3. Structure-based drug design: Use recombinant nuoA structural information to design targeted inhibitors

    4. Adjunctive therapy potential: Evaluate respiratory chain inhibitors as adjuncts to conventional antibiotics for enhanced plague treatment

    The emergence of antibiotic-resistant Y. pestis strains necessitates exploration of alternative therapeutic targets, making metabolic enzymes like nuoA worthy of investigation despite the current focus on traditional virulence factors .

  • What are the key considerations for designing experiments to study nuoA function in different stages of Y. pestis infection?

    Y. pestis encounters dramatically different environments during its transmission cycle between fleas and mammals. Experimental design for nuoA functional studies should account for these transitions:

    Infection StageExperimental ConsiderationsMethodological Approach
    Flea vector phaseLow temperature (22-30°C), blood meal environmentIn vitro biofilm formation assays at flea-relevant temperatures
    Mammalian infection initiationTemperature shift to 37°C, innate immune exposureHuman/mouse macrophage infection models
    Bubonic phaseLymphatic system, neutrophil responseMurine bubonic plague model measuring lymph node bacterial load
    Pneumonic phaseAerosol exposure, pulmonary environmentInhalation challenge model in appropriate animal systems

    Considering Y. pestis' ability to cause different disease forms (bubonic, septicemic, and pneumonic plague) , it's essential to evaluate nuoA's role across these distinct infection scenarios, potentially revealing stage-specific functions or regulatory patterns.

Technical Considerations

  • What quality control metrics should be applied when working with recombinant Y. pestis nuoA?

    Ensuring recombinant nuoA quality is critical for reliable experimental results. Standard quality control procedures should include:

    1. Purity assessment: >90% purity by SDS-PAGE analysis

    2. Functionality verification: Biochemical assays confirming NADH oxidation activity

    3. Structural integrity validation: Circular dichroism spectroscopy to confirm proper protein folding

    4. Endotoxin testing: LAL assay to ensure preparations are endotoxin-free for immunological studies

    5. Stability monitoring: Regular verification of protein stability during storage using activity assays

    For membrane proteins like nuoA, additional considerations include proper solubilization conditions and verification of membrane insertion in reconstitution experiments. Appropriate detergent selection is critical for maintaining functional integrity during purification and storage .

  • How can researchers effectively integrate nuoA studies into broader Y. pestis systems biology approaches?

    Effective integration of nuoA-focused research into systems-level understanding of Y. pestis requires:

    1. Data standardization: Ensure compatibility with existing Yersiniomics databases by following standardized protocols and data formats

    2. Multi-scale modeling: Incorporate nuoA functional data into metabolic models of Y. pestis pathogenesis

    3. Comparative analysis: Systematically compare nuoA function across diverse Y. pestis strains and related Yersinia species

    4. Temporal profiling: Capture dynamic changes in nuoA expression and interaction networks throughout infection stages

    5. Integration with virulence models: Connect nuoA function to established virulence mechanisms like Type III secretion system activity

    The Yersiniomics platform provides valuable resources for such integration, allowing researchers to contextualize nuoA-specific findings within the broader landscape of Y. pestis biology and pathogenesis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.