Recombinant Yersinia pestis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Yersinia pestis NADH-quinone oxidoreductase subunit K (nuoK) is a bacterially expressed protein component of the NADH dehydrogenase complex (Complex I), which catalyzes electron transfer from NADH to quinone in the respiratory chain . This subunit is critical for maintaining the proton gradient across the bacterial membrane, supporting ATP synthesis and energy metabolism .

Table 1: Recombinant nuoK Variants and Production Systems

Host SystemPurityTagStrain/SourceProduct Code
E. coli≥85%His-tagY. pestis bv. AntiquaCSB-BP371838EJE1
Yeast≥85%UndeterminedY. pestis Pestoides FCSB-YP371838EJE1
Baculovirus≥85%UndeterminedY. pseudotuberculosisCSB-CF394514YAL

Expression and Purification

Recombinant nuoK is produced via heterologous expression in systems such as E. coli, yeast, or baculovirus, followed by affinity chromatography . Key parameters:

  • Purity: Validated by SDS-PAGE (≥85%) .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -80°C .

Research Applications

  • Antibody Development: Used as an antigen in ELISA kits for detecting Y. pestis infections .

  • Enzyme Kinetics: Studies on electron transfer mechanisms and inhibitor binding (e.g., pyridaben, rotenone) .

  • Structural Biology: Supports cryo-EM studies to map the quinone-binding site in Complex I .

Table 2: Subunit Comparison in Yersinia pestis NADH Dehydrogenase

SubunitGeneFunctionHost Systems Used
nuoKnuoKQuinone binding and proton pumpingE. coli, yeast, insect cells
nuoAnuoANADH oxidationE. coli, mammalian cells
nuoBnuoBIron-sulfur cluster coordinationE. coli

Inhibitor Studies and Therapeutic Potential

  • Binding Site: The PSST/NQO6 homolog in Y. pestis nuoK is a target for pyridaben and rotenone, which block electron transfer to quinone .

  • Antimicrobial Targets: Inhibitors like aurachin disrupt Na+-pumping activity in related enzymes (e.g., Vibrio cholerae Na+-NQR), suggesting potential cross-reactivity .

Challenges and Future Directions

  • Structural Resolution: Full-length nuoK expression remains challenging due to hydrophobic transmembrane domains .

  • Vaccine Development: While nuoK is not directly used in plague vaccines, its role in bacterial metabolism highlights its utility in drug discovery .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please communicate this need in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag type if possible.
Synonyms
nuoK; YPDSF_1956; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEVMINAAALAFVVAGSYWGQADGQV MYILAITLAAAEASIGLALLLQLYRRRHTLDIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples this redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), conserving the redox energy as a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K (nuoK) and its function in Yersinia pestis?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory chain complex I in Yersinia pestis. This protein, also known as NADH dehydrogenase I subunit K or NDH-1 subunit K, has an EC number of 1.6.99.5 . The nuoK protein plays a critical role in energy metabolism by participating in electron transfer during oxidative phosphorylation.

In Y. pestis, the protein consists of 100 amino acids with the sequence: MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEVMINAAAlafvvagsywgqadgqvmyilaitlaaaeasiglalllqlyrrrhtldidtvsemrg . This membrane-integrated protein is part of the larger NADH-quinone oxidoreductase complex that couples electron transfer to proton translocation across the bacterial membrane.

How can researchers obtain and work with recombinant Y. pestis nuoK?

Researchers can work with recombinant Y. pestis nuoK through several approaches:

  • Commercial sources: Recombinant nuoK protein is available from suppliers as research reagents. These typically come as purified proteins suitable for ELISA and other applications .

  • Expression systems: Researchers can express recombinant nuoK using prokaryotic expression systems. The protein can be expressed with fusion tags (commonly His-tag) to facilitate purification, similar to the approach used for related NADH-quinone oxidoreductase subunits in other species .

  • Storage and handling: Recombinant nuoK is typically supplied in a Tris-based buffer with 50% glycerol and should be stored at -20°C or -80°C for extended storage. It's recommended to avoid repeated freeze-thaw cycles and to keep working aliquots at 4°C for up to one week .

What experimental techniques are most effective for studying nuoK function?

Several methodological approaches can be employed to study nuoK function:

  • Gene deletion and complementation: Similar to studies of other Y. pestis proteins like Ail, deletion mutants (ΔnuoK) can be created and complemented with wild-type nuoK at a neutral chromosomal site to confirm phenotypes .

  • Protein-protein interaction studies: Techniques like bacterial two-hybrid systems, co-immunoprecipitation, or crosslinking coupled with mass spectrometry can identify interaction partners within the respiratory complex.

  • Membrane protein purification: Due to nuoK's membrane localization, specialized techniques involving detergents are necessary for maintaining protein stability during purification.

  • Enzymatic activity assays: NADH oxidation assays can measure the activity of the complex containing nuoK, though isolating the specific contribution of nuoK requires careful experimental design.

How does nuoK contribute to Y. pestis pathogenesis and adaptation during host-flea transmission cycles?

While the direct role of nuoK in Y. pestis pathogenesis has not been extensively characterized, respiratory chain components likely play important roles in the pathogen's adaptation to different hosts. Y. pestis must adapt to temperature shifts when transitioning from the flea vector (ambient temperature) to mammalian hosts (37°C) .

Respiratory chain components like nuoK may contribute to these adaptations by:

  • Energy metabolism regulation: During transition between hosts, Y. pestis undergoes significant metabolic reprogramming.

  • Adaptation to oxygen availability: Different tissues in mammalian hosts present varying oxygen tensions, requiring respiratory chain adjustments.

  • Survival within phagocytes: Early in infection, Y. pestis survives within host innate immune cells, where respiratory adaptation is crucial .

A comprehensive experimental approach to study these aspects would include:

  • Growth rate measurements of wild-type and nuoK mutant strains under various temperatures and oxygen conditions

  • Transcriptomic and proteomic analyses of respiratory chain components during host shifts

  • Infection models to assess the contribution of nuoK to virulence

How does the structure-function relationship of nuoK inform potential drug targeting strategies?

The nuoK protein, with its 100 amino acids in Y. pestis (strain Pestoides F), has a highly hydrophobic nature consistent with its membrane localization . Structural analysis reveals:

  • Transmembrane domains: The sequence suggests multiple transmembrane spans, typical of respiratory chain components.

  • Conserved residues: Comparing nuoK across bacterial species can highlight evolutionarily conserved residues likely essential for function.

For drug development strategies, researchers should consider:

  • Essential residues identification: Site-directed mutagenesis of conserved amino acids to identify those critical for function.

  • Protein-protein interaction surfaces: Mapping interfaces between nuoK and other complex I components to identify potential disruptive compounds.

  • Species-specific features: Identifying structural elements unique to Y. pestis nuoK not present in human homologs to ensure therapeutic specificity.

ApproachMethodologyExpected Outcome
Structural determinationCryo-EM or X-ray crystallography3D structure revealing drug-targetable pockets
Molecular dynamicsComputer simulationConformational changes during electron transfer
Comparative genomicsSequence alignment across speciesIdentification of Y. pestis-specific features
Functional assaysSite-directed mutagenesisCritical residues for enzyme function

How can researchers distinguish between the roles of different NADH-quinone oxidoreductase subunits in Y. pestis?

Distinguishing the specific roles of individual subunits within the NADH-quinone oxidoreductase complex presents significant experimental challenges. Researchers can employ these strategies:

  • Individual subunit knockout studies: Creating a panel of mutants, each lacking a single subunit (nuoB, nuoK, etc.), and comparing phenotypes .

  • Complementation with chimeric proteins: Replacing Y. pestis nuoK with orthologs from related species like Y. pseudotuberculosis to identify species-specific functions.

  • Point mutations in conserved domains: Introducing specific mutations in functional domains rather than complete deletions.

  • Subunit-specific antibodies: Developing antibodies against each subunit to track their expression and localization under different conditions.

  • Crosslinking studies: Using chemical crosslinkers followed by mass spectrometry to map the topology and interactions between subunits.

Data interpretation requires careful consideration of:

  • Polar effects when deleting individual genes within the nuo operon

  • Assembly issues when individual subunits are missing

  • Compensatory mechanisms that may mask phenotypes

What is the potential role of nuoK in Y. pestis antimicrobial resistance?

The respiratory chain represents a potential target for antimicrobial development, with several aspects relevant to nuoK:

  • Metabolic requirement: As part of complex I, nuoK contributes to energy production critical for bacterial growth and virulence.

  • Bacterial persistence: Respiratory chain modulation may contribute to bacterial persistence under stress conditions, including antibiotic exposure.

  • Biofilm formation: Respiratory chain components may influence biofilm formation, which can contribute to antimicrobial resistance.

Experimental approaches to investigate these connections include:

  • Minimum inhibitory concentration (MIC) testing: Comparing antimicrobial susceptibility between wild-type and nuoK mutant strains.

  • Persister cell formation assays: Assessing whether nuoK mutants show altered ability to form antibiotic-tolerant persister cells.

  • Combination therapy evaluation: Testing whether respiratory chain inhibitors potentiate conventional antibiotics against Y. pestis.

How does nuoK compare between Y. pestis and its ancestral species Y. pseudotuberculosis?

Y. pestis evolved from Y. pseudotuberculosis relatively recently but adopted a dramatically different lifestyle . Comparing nuoK between these species may reveal adaptations associated with this evolutionary transition:

  • Sequence comparison: Analyzing nuoK sequence conservation and divergence points.

  • Expression pattern differences: Examining whether nuoK regulation differs between species, particularly in response to temperature shifts.

  • Functional complementation: Testing whether nuoK from one species can functionally replace the ortholog in the other.

These studies may provide insights into how the respiratory chain adapted during Y. pestis evolution from an enteric pathogen to a vector-borne pathogen with a systemic infection strategy.

What are the methodological challenges in studying membrane proteins like nuoK?

Membrane proteins like nuoK present specific experimental challenges:

  • Protein expression and purification:

    • Overexpression often leads to toxicity or inclusion body formation

    • Requires detergent optimization for extraction from membranes

    • May need specialized expression systems for proper folding

  • Structural studies:

    • Difficult to crystallize for X-ray diffraction

    • Often requires lipid reconstitution for native-like conformation

    • May need fusion partners to enhance stability

  • Functional assays:

    • Must be performed in membrane-mimetic environments

    • Activity often depends on proper assembly with other complex components

    • May require reconstitution of multiple subunits

Researchers should consider these approaches:

  • Using mild detergents like n-dodecyl-β-D-maltoside

  • Nanodiscs or liposomes for functional reconstitution

  • Cryo-EM as an alternative to crystallography for structural determination

How can nuoK research contribute to new plague prevention and treatment strategies?

Research on nuoK and other respiratory chain components may contribute to plague countermeasures in several ways:

  • Novel drug targets: Respiratory chain inhibitors specifically targeting Y. pestis components could provide alternatives to traditional antibiotics.

  • Vaccine development: Understanding metabolic requirements during infection could inform rational attenuation strategies. Current plague vaccines have limitations in preventing pneumonic plague, and improved vaccines are needed .

  • Diagnostic targets: Metabolic signatures involving respiratory components could be developed into diagnostic markers.

The development of such approaches requires:

  • Target validation using animal models of infection

  • Assessment of target essentiality in different infection stages

  • Evaluation of cross-reactivity with human or commensal bacterial proteins

How does nuoK function adapt during Y. pestis transition between mammalian and flea environments?

Y. pestis faces dramatically different environments during its life cycle, requiring adaptive metabolic strategies. Key experimental questions include:

  • Temperature-dependent expression: Does nuoK expression or activity change between flea temperature (~25°C) and mammalian host temperature (37°C)?

  • Nutrient adaptation: How does nuoK function adjust to different carbon sources available in these environments?

  • Oxygen tension response: Does nuoK play a role in adaptation to varying oxygen levels encountered during infection?

Researchers investigating these questions should design experiments that simulate these transitions, measuring changes in:

  • Gene expression profiles

  • Protein levels and modifications

  • Enzymatic activities

  • Bacterial growth and survival

These studies would contribute to understanding the "key Y. pestis physiological and virulence traits that are important for its mammal-flea-mammal life cycle" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.