Recombinant Yersinia pestis p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
aaeA; YPDSF_0292; p-hydroxybenzoic acid efflux pump subunit AaeA; pHBA efflux pump protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
aaeA
Target Protein Sequence
MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG
Uniprot No.

Target Background

Function
Forms an efflux pump in conjunction with AaeB.
Database Links
Protein Families
Membrane fusion protein (MFP) (TC 8.A.1) family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Yersinia pestis p-hydroxybenzoic acid efflux pump subunit AaeA and what is its function?

The AaeA protein functions as a membrane fusion protein (MFP) component of the AaeAB efflux pump system in Y. pestis. It works in conjunction with AaeB to form a functional efflux pump that exports aromatic carboxylic acids, particularly p-hydroxybenzoic acid (pHBA), from the bacterial cell. This system serves as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism when these compounds accumulate to potentially harmful levels . In E. coli, the AaeA (formerly known as YhcQ) and AaeB (formerly YhcP) proteins together are necessary and sufficient for resistance to pHBA toxicity, suggesting a similar protective role in Y. pestis .

How is the aaeA gene organized within the Y. pestis genome?

Based on homology with the well-characterized E. coli system, the aaeA gene in Y. pestis is likely part of an operon structure that includes aaeX (formerly yhcR), aaeA (formerly yhcQ), and aaeB (formerly yhcP) genes . This operon is regulated by a divergently transcribed gene, aaeR (formerly yhcS), which encodes a LysR family transcriptional regulator that controls expression in response to aromatic carboxylic acids . The gene organization reflects the functional relationship between these components in forming the complete efflux system.

What experimental evidence confirms the efflux function of the AaeAB system?

The efflux function was experimentally demonstrated in E. coli through several complementary approaches. Most definitively, deletion of the yhcP (aaeB) gene resulted in hypersensitivity to pHBA, confirming its role in exporting this toxic compound . Additionally, a yhcS (aaeR) mutant strain was also hypersensitive to pHBA, but this hypersensitivity could be suppressed by expression of yhcQ (aaeA) and yhcP (aaeB), confirming that these two proteins are both necessary and sufficient for the efflux function . Similar functional characterization can be performed for the Y. pestis homolog.

How is expression of the aaeA gene regulated in Y. pestis?

Expression of the aaeA gene, based on the E. coli model, is regulated by AaeR (formerly YhcS), a LysR-type transcriptional regulator . The AaeR protein responds to the presence of aromatic carboxylic acids in the environment or those produced during metabolism. When activated by these compounds, AaeR binds to the promoter region of the aaeXAB operon, inducing its expression . In experimental studies with E. coli, the level of gene expression increased with increasing concentration of pHBA, reaching up to a 145-fold increase at 50 mM pHBA, though expression decreased at 100 mM, likely due to cellular toxicity .

What compounds can induce expression of the aaeA gene?

Several aromatic carboxylic acid compounds serve as inducers of aaeA expression. In E. coli, p-hydroxybenzoic acid (pHBA) is a potent inducer, causing dramatic upregulation of the aaeXAB operon . The specificity of this response suggests that the AaeAB system has evolved to respond specifically to aromatic carboxylic acids, rather than functioning as a general multidrug efflux pump like AcrAB-TolC . This narrow substrate specificity distinguishes AaeAB from other efflux systems and points to its specialized role in bacterial metabolism.

How does the expression of aaeA change under different growth conditions?

The expression of aaeA is primarily induced by the presence of its substrates, particularly pHBA. The level of induction is concentration-dependent, with higher substrate concentrations generally resulting in higher expression levels up to a threshold where toxicity effects become dominant . Other growth conditions that might affect expression include the metabolic state of the cell, as the AaeAB system appears to function as a "metabolic relief valve" to alleviate toxic effects of imbalanced metabolism . Research examining how different growth phases, nutrient availability, and environmental stresses affect aaeA expression would provide valuable insights.

What are the key structural domains of the AaeA protein and how do they contribute to its function?

AaeA belongs to the membrane fusion protein (MFP) family, which typically contain several functional domains . While specific structural studies of Y. pestis AaeA are not detailed in the available literature, MFPs generally include a membrane-proximal domain that anchors to the inner membrane, a β-barrel domain, and an α-helical domain that interacts with outer membrane components. These domains work together to create a channel that spans the periplasmic space, allowing substrates transported by AaeB to be efficiently exported from the cell. Structural studies using X-ray crystallography or cryo-electron microscopy would provide more detailed insights into Y. pestis AaeA's specific domain organization.

How does the AaeAB efflux system differ from other efflux pumps in Y. pestis, such as AcrAB-TolC?

The AaeAB efflux system differs from the AcrAB-TolC system in several important ways:

CharacteristicAaeAB SystemAcrAB-TolC System
Substrate specificityNarrow (aromatic carboxylic acids)Broad (antibiotics, dyes, detergents)
Outer membrane componentNot clearly definedTolC
RegulationAaeR (LysR family)Multiple regulators
Role in antibiotic resistanceLimitedSignificant
Response to efflux pump inhibitorsNot inhibited by PAβNInhibited by PAβN

The AaeAB system shows specificity for a narrow range of aromatic carboxylic acids, while AcrAB-TolC has broad substrate specificity and is involved in resistance to diverse antibiotics and other compounds . Additionally, unlike AcrAB-TolC, the Y. pestis AcrAB pump efficiently effluxes PAβN (phenylalanine-arginine beta-naphthylamide) but is minimally inhibited by it, a distinctive characteristic compared to E. coli and P. aeruginosa homologs .

What is the substrate specificity profile of the AaeAB efflux pump?

The AaeAB efflux pump demonstrates a narrow substrate specificity focused primarily on aromatic carboxylic acids. In E. coli studies, "only a few aromatic carboxylic acids of hundreds of diverse compounds tested were defined as substrates of the YhcQP (AaeAB) efflux pump" . This narrow specificity suggests that the AaeAB system evolved for a specific physiological function related to aromatic carboxylic acid metabolism, rather than as a general defense mechanism against diverse toxic compounds. The specific structural features of substrates that determine recognition by AaeAB would be an important area for further research with the Y. pestis homolog.

What are the optimal methods for producing recombinant Y. pestis AaeA protein for structural and functional studies?

Production of recombinant Y. pestis AaeA protein typically involves:

  • Gene cloning: The aaeA gene can be amplified from Y. pestis genomic DNA using PCR with specific primers containing appropriate restriction sites.

  • Expression vector construction: The amplified gene is cloned into an expression vector (e.g., pET series) containing an affinity tag (His-tag, GST-tag) to facilitate purification.

  • Expression optimization: Expression conditions (temperature, inducer concentration, duration) must be optimized. For membrane-associated proteins like AaeA, lower expression temperatures (16-25°C) often yield better results.

  • Membrane extraction: Since AaeA is a membrane fusion protein, appropriate detergents must be used for extraction from the membrane fraction.

  • Purification: Affinity chromatography followed by size exclusion chromatography can yield pure protein suitable for functional and structural studies.

For functional studies, co-expression with AaeB may be necessary to maintain proper folding and interactions between the efflux pump components .

What assays can be used to evaluate the function of recombinant AaeA protein in vitro?

Several complementary approaches can be used to assess AaeA function:

  • Substrate binding assays: Using techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) to measure direct binding of aromatic carboxylic acids to purified AaeA protein.

  • Reconstitution in proteoliposomes: AaeA and AaeB can be reconstituted into artificial membrane vesicles to measure substrate transport directly.

  • ATPase activity assays: If the AaeAB system is energy-dependent, coupling of substrate transport to ATP hydrolysis can be measured.

  • Fluorescent substrate accumulation: Using fluorescent derivatives of known substrates to monitor efflux activity in membrane vesicles.

  • Protein-protein interaction assays: Techniques such as bacterial two-hybrid systems or co-immunoprecipitation to study interactions between AaeA, AaeB, and potential outer membrane components of the efflux system.

These approaches provide complementary data about different aspects of AaeA function .

How can researchers generate Y. pestis mutants lacking aaeA to study its physiological role?

Generation of Y. pestis ΔaaeA mutants can be accomplished through several methods:

  • Lambda Red recombination: This efficient system enables precise deletion of the aaeA gene by replacing it with an antibiotic resistance cassette flanked by FRT sites.

  • CRISPR-Cas9 genome editing: This approach can create precise deletions without leaving marker sequences in the genome.

  • Suicide plasmid integration: Using vectors that cannot replicate in Y. pestis to deliver homologous regions for recombination.

After generating the mutant, phenotypic characterization should include:

  • Growth curves in the presence of various aromatic carboxylic acids

  • Minimum inhibitory concentration (MIC) determination for potential substrates

  • Transcriptomic analysis to identify compensatory mechanisms

  • Virulence assessment in appropriate animal models

Similar approaches have been used successfully to study the role of the AcrAB-TolC efflux system in Y. pestis .

How does Y. pestis AaeA compare to its homologs in E. coli and other bacteria?

Y. pestis AaeA shares significant homology with its E. coli counterpart, reflected in their similar functions in aromatic carboxylic acid efflux. Based on the available data, the following comparative analysis can be drawn:

CharacteristicY. pestis AaeAE. coli AaeA (YhcQ)Other Bacterial Homologs
Functional roleEfflux of aromatic carboxylic acidsEfflux of aromatic carboxylic acidsVariable, depending on species
Regulatory mechanismLikely AaeR-dependentAaeR-dependentVariable LysR-type regulators
Genomic contextLikely in aaeXAB operonIn aaeXAB operonOften adjacent to transporter genes
Substrate specificityPresumed narrowNarrow (few aromatic carboxylic acids)Variable

The functional conservation between Y. pestis and E. coli systems suggests an important role in bacterial metabolism that has been maintained through evolution .

How has the AaeAB efflux system evolved across different Yersinia species?

Evolutionary analysis of the AaeAB system across Yersinia species could provide insights into adaptation to different ecological niches. Y. pestis evolved relatively recently from Y. pseudotuberculosis, but has adapted to a dramatically different lifestyle involving transmission by fleas and causing systemic infection in mammals. Comparative genomic analysis of aaeA and related genes across the Yersinia genus would reveal whether this system has undergone selection during this evolutionary transition. Genetic differences might reflect adaptation to different host environments, metabolic requirements, or virulence strategies. Synteny analysis (examining gene order conservation) could also reveal whether the operon structure has been maintained across species, providing insights into the evolutionary importance of coordinated expression of these genes.

How does the AaeAB efflux system potentially contribute to Y. pestis virulence and pathogenesis?

While the direct contribution of AaeAB to Y. pestis virulence remains to be fully characterized, several potential mechanisms can be proposed:

  • Aromatic compound detoxification: The ability to efflux potentially toxic aromatic compounds encountered within host environments could contribute to bacterial survival.

  • Metabolic adaptation: By functioning as a "metabolic relief valve," AaeAB may help Y. pestis adapt to the changing metabolic conditions encountered during infection.

  • Host-derived antimicrobial resistance: The system might confer resistance to certain host-derived antimicrobial compounds with aromatic carboxylic acid moieties.

Interestingly, studies of the related AcrAB-TolC efflux system in Y. pestis found that pump deletion did not significantly affect tissue colonization in mouse plague models, suggesting that not all efflux systems directly impact virulence . Specific studies focusing on AaeAB would be needed to determine its role in pathogenesis.

Could AaeA be a potential target for novel antimicrobial therapies against Y. pestis?

AaeA represents a potential but challenging target for antimicrobial development:

Potential advantages:

  • Inhibition could increase bacterial susceptibility to toxic compounds

  • System appears to be important for metabolic homeostasis

  • Target is absent in human cells

Challenges:

  • Narrow substrate specificity means inhibitors might not broadly sensitize to antibiotics

  • Functional redundancy with other efflux systems might limit efficacy

  • Membrane-associated proteins are often difficult drug targets

Could recombinant AaeA protein be utilized in vaccine development against Y. pestis?

While AaeA itself has not been identified as a protective antigen in the available literature, research on other Y. pestis outer membrane proteins provides insights into potential vaccine applications:

  • Outer membrane protein antigens: Studies have identified several Y. pestis outer membrane proteins, including Ail/OmpX, Pla, OmpA, and F1, that react with hyperimmune sera from animals infected with plague and subsequently rescued with levofloxacin .

  • Protective efficacy: Antibodies against some of these outer membrane proteins provided protection in animal models. For example, antibodies to Ail and OmpA protected mice against bubonic plague when challenged with an F1-negative Y. pestis strain, while Pla antibodies were protective against pneumonic plague .

  • Potential for recombinant subunit vaccines: The addition of Y. pestis outer membrane proteins to new-generation recombinant vaccines could provide protection against a wider variety of Y. pestis strains, including those lacking traditional vaccine targets like F1 .

What are the most promising approaches for determining the three-dimensional structure of Y. pestis AaeA?

Several complementary approaches could be employed to elucidate the structure of AaeA:

  • X-ray crystallography: This would require production of highly purified, homogeneous protein samples capable of forming well-ordered crystals. For membrane-associated proteins like AaeA, this often requires careful detergent selection or the use of lipidic cubic phase crystallization methods.

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have revolutionized structural biology of membrane proteins. This approach could be particularly valuable for studying the AaeA-AaeB complex in its native conformation.

  • Nuclear magnetic resonance (NMR) spectroscopy: While challenging for larger proteins, NMR could provide valuable information about dynamic regions and substrate binding sites.

  • Integrative structural biology: Combining multiple experimental approaches (e.g., small-angle X-ray scattering, hydrogen-deuterium exchange mass spectrometry) with computational modeling to build a comprehensive structural model.

These structural studies would provide crucial insights into AaeA function and potential interactions with inhibitors or other system components.

How might systems biology approaches advance our understanding of AaeAB function in Y. pestis?

Systems biology approaches could provide a more holistic understanding of AaeAB function:

These approaches would place AaeAB function in the broader context of Y. pestis biology and potentially identify new roles beyond the currently recognized efflux of aromatic carboxylic acids.

What experimental approaches could best elucidate the role of AaeAB in Y. pestis interaction with host cells?

Several experimental approaches could investigate the potential role of AaeAB in host interaction:

  • Infection studies with ΔaaeA mutants: Compare the ability of wild-type and ΔaaeA Y. pestis to infect and survive within various host cell types (macrophages, neutrophils, epithelial cells).

  • Transcriptional analysis during infection: Measure aaeA expression levels during different stages of infection to determine when the system is most active.

  • Metabolite profiling during host interaction: Identify host-derived compounds that might be substrates for AaeAB during infection.

  • Animal models of infection: Compare virulence of wild-type and ΔaaeA Y. pestis in various animal models of bubonic and pneumonic plague, similar to studies conducted with other efflux systems .

  • Immune response analysis: Determine whether AaeA affects host immune recognition of Y. pestis or modulates inflammatory responses.

These studies would provide valuable insights into whether AaeAB plays a specific role during host interaction or primarily functions in basic bacterial metabolism regardless of environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.