Recombinant Yersinia pestis Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for customers.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your desired tag type at the time of ordering for preferential development.
Synonyms
arnF; YPDSF_0734; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
arnF
Target Protein Sequence
MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYFVQLASVMCGLMGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATLLKTLGAGFILLGIWLI NIKPIKAS
Uniprot No.

Target Background

Function
This protein, ArnF, functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase, translocating 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane from the cytoplasm to the periplasm.
Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Yersinia pestis ArnF protein?

The ArnF protein in Y. pestis functions as a subunit of the 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase complex. Based on computational modeling approaches similar to those used for E. coli ArnF, the protein likely contains multiple transmembrane domains characteristic of membrane flippases. Structure prediction using AlphaFold-type approaches typically yields models with global pLDDT scores around 70-90, indicating moderate to high confidence in the predicted structure . The protein's conformation includes both highly structured transmembrane regions and more flexible loop regions connecting them.

How does recombinant ArnF compare structurally to other virulence factors in Y. pestis?

Unlike the well-characterized F1 capsular antigen of Y. pestis, which forms high molecular mass multimers critical for virulence, ArnF is a membrane protein with distinct structural properties . The F1 antigen exists as a multimer that dissociates after heating in the presence of SDS and reassociates upon SDS removal, with this multimeric state being crucial for protection against Y. pestis challenge . In contrast, ArnF likely maintains its functional state through proper membrane integration rather than multimerization. Structural studies of ArnF would require membrane protein purification techniques unlike those used for F1 antigen, which can be purified by ammonium sulfate fractionation followed by gel filtration chromatography.

What expression systems are recommended for producing recombinant Y. pestis ArnF?

Based on the successful expression of other Y. pestis recombinant proteins, several expression systems could be considered:

Expression SystemAdvantagesLimitationsPurification Strategy
E. coliFast growth, high yield, established protocolsPotential improper folding of membrane proteinsDetergent extraction, affinity chromatography
Plant-based (e.g., N. benthamiana)Very rapid expression, high levels possible, proper eukaryotic protein processingMore complex setup requiredSimilar to methods used for F1/V antigens
Yeast expression systemsBetter for membrane proteins than E. coliLower yields than bacterial systemsDensity gradient centrifugation, chromatography

For membrane proteins like ArnF, yeast or insect cell systems may provide advantages for proper folding and membrane insertion compared to bacterial systems . The plant-based approach using deconstructed tobacco mosaic virus-based systems has shown success with other Y. pestis antigens like F1 and V, producing high yields rapidly .

What are the optimal methods for purifying functionally active recombinant ArnF protein?

Purification of membrane proteins like ArnF requires specialized approaches:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions containing the recombinant protein

  • Solubilization: Careful selection of detergents (e.g., DDM, LDAO) to extract ArnF while maintaining its native conformation

  • Chromatography: IMAC (immobilized metal affinity chromatography) if His-tagged, followed by size exclusion chromatography

  • Functional assessment: Proteoliposome reconstitution to assess flippase activity

The purification strategy should be validated using both activity assays and structural assessment methods like circular dichroism to ensure the recombinant protein maintains its native structure throughout the purification process, similar to approaches used for F1 antigen characterization .

How can researchers assess the functional activity of purified recombinant ArnF?

Assessing ArnF flippase activity requires specialized methods to detect the translocation of 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol across membranes:

  • Reconstitution into proteoliposomes with fluorescently labeled lipid substrates

  • Tracking substrate translocation using fluorescence quenching assays

  • Mass spectrometry-based approaches to detect substrate modifications

  • Complementation assays in bacterial strains with ArnF deletions

Results should be compared with positive controls (known functional flippases) and negative controls (inactive ArnF mutants or empty vesicles) to ensure assay specificity and sensitivity.

What analytical techniques are most informative for characterizing recombinant ArnF structure?

Multiple complementary techniques should be employed:

TechniqueInformation ProvidedSample Requirements
Circular DichroismSecondary structure content, thermal stability0.1-1 mg/ml purified protein
FTIR SpectroscopySecondary structure in membrane environmentConcentrated protein samples
Native Mass SpectrometryOligomeric state, ligand bindingDetergent-solubilized samples
Cryo-EMHigh-resolution structure if well-behavedHighly pure, homogeneous samples
X-ray CrystallographyAtomic resolution if crystals formDiffracting crystals
AlphaFold2 PredictionComputational structure modelSequence information only

Similar to the approach used for monitoring F1 antigen reassociation, circular dichroism can track structural changes in ArnF under different conditions .

What is the role of ArnF in Y. pestis virulence and antibiotic resistance?

The ArnF protein likely contributes to Y. pestis virulence through its role in lipopolysaccharide (LPS) modification. As part of the Arn pathway:

  • ArnF facilitates the translocation of 4-amino-4-deoxy-L-arabinose to the outer leaflet of the inner membrane

  • This modification alters LPS structure, reducing the negative charge of the bacterial surface

  • Modified LPS provides resistance to cationic antimicrobial peptides and certain antibiotics

  • This resistance mechanism may enhance Y. pestis survival within host phagocytes

This function differs from the direct immunomodulatory role of capsular proteins like F1 antigen, which helps Y. pestis resist phagocytosis through different mechanisms . For comprehensive virulence studies, researchers should consider both ArnF-mediated and F1-mediated protection mechanisms.

How does ArnF function compare across different Yersinia species and strains?

Comparative analysis of ArnF across Yersinia species provides insights into evolution and host adaptation:

Species/StrainArnF Sequence HomologyFunctional DifferencesEpidemiological Context
Y. pestis strains>95% identityMinimal variationPlague pathogen
Y. pseudotuberculosis~90% identitySimilar functionAncestral species
Y. enterocolitica~70% identityPossible functional divergenceGastrointestinal pathogen

The high conservation of ArnF across Y. pestis strains, including those involved in the 2017 Madagascar outbreak , suggests its essential role in Y. pestis biology. Researchers should consider strain-specific variations when designing experimental systems.

How does recombinant ArnF interact with host immune responses compared to other Y. pestis antigens?

  • T-cell responses to ArnF-derived peptides

  • Antibody accessibility to exposed ArnF epitopes

  • Potential for ArnF-targeting approaches to disrupt bacterial resistance mechanisms

  • Comparative immunogenicity of ArnF versus established vaccine antigens like F1-V fusion proteins

While F1 and V antigens provide significant protection in animal models and have advanced to human trials, ArnF's potential as a complementary vaccine component remains to be thoroughly explored .

What are the most effective experimental designs for studying ArnF function in Y. pestis pathogenesis models?

Advanced research on ArnF requires carefully designed experiments:

  • Gene knockout/complementation: Create clean arnF deletion mutants and complemented strains

  • Site-directed mutagenesis: Target conserved residues to identify functional domains

  • Conditional expression systems: Regulate ArnF levels to assess dosage effects

  • Fluorescent protein fusions: Track protein localization while minimizing functional disruption

  • Animal infection models: Compare ΔarnF mutant virulence to wild-type Y. pestis

When evaluating protection against Y. pestis challenge, researchers should standardize infection doses (e.g., 1 × 10^6 CFU) similar to those used in F1 antigen studies and employ appropriate animal models (mice, guinea pigs) that have demonstrated relevance to human disease .

How can structural data be integrated with functional studies to identify ArnF inhibitors as potential therapeutics?

A structure-guided drug discovery approach would involve:

  • High-resolution structural determination (X-ray, Cryo-EM) or refined computational modeling (AlphaFold2)

  • Identification of substrate binding pockets and catalytic sites

  • Virtual screening of compound libraries against these sites

  • Biophysical validation of binding (thermophoresis, SPR)

  • Functional assessment of inhibition (flippase activity assays)

  • Evaluation of effects on bacterial resistance and virulence

This approach differs from vaccine-oriented strategies focusing on F1 and V antigens but could provide complementary therapeutic options targeting different aspects of Y. pestis pathogenesis.

What methodological approaches can resolve contradictory findings about ArnF functions in different experimental systems?

When faced with conflicting data, researchers should:

  • Standardize experimental conditions across different laboratories

  • Directly compare protein expression levels and localization

  • Use multiple independent functional assays

  • Consider strain-specific genetic variations

  • Account for environmental factors affecting ArnF expression

  • Implement statistical methods to identify significant variables

This is particularly important given the different Y. pestis lineages that can emerge during outbreaks, as documented in the Madagascar epidemic where multiple distinct lineages were identified .

How does research on ArnF complement studies of established Y. pestis vaccine antigens?

While F1 and V antigens have demonstrated efficacy as vaccine components , ArnF research offers complementary perspectives:

  • ArnF targets bacterial resistance mechanisms rather than direct virulence factors

  • Combined approaches targeting both virulence (F1/V) and resistance (ArnF) could provide enhanced protection

  • ArnF's high conservation might offer broader protection against diverse Y. pestis strains

  • Understanding ArnF function provides insights into bacterial adaptation during infection

The established immunization protocols using recombinant F1 and V antigens administered subcutaneously could potentially be adapted to incorporate ArnF-derived components if they demonstrate additional protective value.

What are the methodological considerations for incorporating ArnF in multi-component plague vaccine research?

Researchers developing multi-component vaccines should consider:

ComponentEstablished EfficacyProduction SystemFormulation Challenges
F1 antigenHigh protection in multimeric form E. coli, plant systems Maintaining multimerization
V antigenStrong protection alone or as F1-V fusion Various expression systemsStability, aggregation
ArnFRequires investigationNeeds optimizationMembrane protein solubility
F1-V fusionHigh protection in animal models Plant systems demonstrate high yield Preserving epitopes

The critical finding that multimeric F1 provides significantly better protection than monomeric F1 highlights the importance of careful protein characterization at each step of vaccine development.

How can transcriptomic and proteomic approaches enhance understanding of ArnF regulation during Y. pestis infection cycles?

Integrated -omics approaches should examine:

  • ArnF expression changes during transitions between flea vector and mammalian host

  • Regulatory networks controlling ArnF expression under different environmental stresses

  • Protein-protein interactions identifying ArnF functional partners

  • Post-translational modifications affecting ArnF activity

  • Comparative expression patterns across different Y. pestis lineages involved in outbreaks

This systems biology perspective would complement the focused structural and functional studies of recombinant ArnF protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.