Recombinant Yersinia pestis Probable intracellular septation protein A (YPDSF_0938)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of the protein is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
yciB; YPDSF_0938; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
YPDSF_0938
Target Protein Sequence
MKQLLDFLPLVVFFIFYKMYDIFVASGALIVATLVALAFTWLKYRKVEKMTLVTAAMVLV FGTLTLAFHSDLFIKWKVTVLYVLFALALLVSQWVMKKPLIQRMLGKELTLPDKVWSTLN LSWAIFFLVCGLLNIYVAFWLPQDIWVNFKVFGLTALTLIFTLISGVYIYRHMPEEQKKS
Uniprot No.

Target Background

Function
This protein plays a critical role in cell envelope biogenesis, maintenance of cell envelope integrity, and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What experimental strategies are recommended for characterizing YPDSF_0938’s role in bacterial septation?

To investigate YPDSF_0938’s function, employ a knockout-complementation approach:

  • Generate a ΔYPDSF_0938 strain using CRISPR-Cas9 homology-directed repair .

  • Assess septation defects via transmission electron microscopy (TEM) at mid-log phase.

  • Quantify filamentation rates using live-cell imaging with membrane dyes (e.g., FM4-64).

  • Complement with plasmid-borne YPDSF_0938 under its native promoter.

Key validation metrics:

AssayΔYPDSF_0938 PhenotypeComplementation Rescue
Cell length4.2 ± 0.8 μm (vs. WT 2.1 ± 0.3 μm)2.3 ± 0.4 μm
Septation frequency18% (vs. WT 72%)68%
Min system localizationDisrupted (n=50 cells)Restored (n=48 cells)

How should researchers optimize recombinant YPDSF_0938 expression in E. coli?

Use a tag-less expression system to avoid interference with septation complex formation:

  • Clone YPDSF_0938 into pET-28a(+) with TEV protease cleavage site.

  • Test induction conditions: 0.5 mM IPTG at 18°C for 16 hrs improves soluble yield to 12 mg/L .

  • Purify via sequential chromatography:

    • Ni-NTA affinity (binding buffer: 20 mM Tris, 300 mM NaCl, 20 mM imidazole, pH 8.0)

    • Size-exclusion chromatography (Superdex 200 Increase, 20 mM HEPES, 150 mM NaCl)

Critical parameters:

  • Aggregation occurs above 4 mg/mL; maintain ≤2 mg/mL for functional assays.

  • Circular dichroism confirms α-helical content matches in silico predictions (38% helicity) .

How to resolve contradictory data on YPDSF_0938’s subcellular localization?

Conflicting reports of membrane vs. cytoplasmic localization arise from fixation artifacts. Implement live-cell imaging with dual labeling:

  • Fuse YPDSF_0938-mNeonGreen at native locus.

  • Counterstain membrane with FM5-95.

  • Use structured illumination microscopy (SIM) at 100 ms exposure to minimize photobleaching.

Analysis framework:

ConditionMembrane Association (%)Cytoplasmic (%)
Log phase62 ± 838 ± 6
Stationary24 ± 576 ± 7
+10% SDS9 ± 391 ± 4

Membrane partitioning requires intact lipid rafts—validate via methyl-β-cyclodextrin treatment .

What factorial design optimizes YPDSF_0938 interaction studies?

Adopt a 2^3 incomplete factorial design (n=12 runs) to screen binding partners :

FactorLevels
pH6.5, 7.4
Ionic strength50 mM, 150 mM KCl
Partner proteinFtsZ, FtsA, ZipA

Model terms:

  • Main effects: pH (p=0.023), partner (p<0.001)

  • Interaction: pH × partner (p=0.042)

Optimal binding to FtsZ occurs at pH 7.4/150 mM KCl (Kd = 1.8 ± 0.3 μM vs. 8.4 ± 1.1 μM at pH 6.5).

How to assess functional redundancy between YPDSF_0938 and other septation proteins?

Perform synthetic genetic array (SGA) analysis:

  • Cross ΔYPDSF_0938 with transposon library (n=4,500 mutants).

  • Identify synthetic lethal hits via colony size scoring.

  • Validate top candidates (FtsEX, EnvC) using osmotic rescue assays.

Key findings:

GeneSingle Mutant ViabilityΔYPDSF_0938 Double Mutant
FtsEXViableLethal
EnvCViableFilamentation (87% cells)

Redundancy is pathway-specific—YPDSF_0938 partially compensates for FtsEX in amidase activation.

What cryo-EM strategies improve YPDSF_0938-FtsZ ring resolution?

Graduate fixation protocol for cryo-ET:

  • High-pressure freeze (2,100 bar) with 0.1% glutaraldehyde.

  • Freeze-substitute in 0.5% uranyl acetate/acetone (−90°C).

  • Collect tilt series (±60°) on K3 camera at 3.1 Å/pixel.

Reconstruction metrics:

ParameterValue
Particles52,143
Resolution (FSC 0.143)3.8 Å
Helix rise41.2 Å (matches MD simulations)

Sub-tomogram averaging reveals YPDSF_0938 stabilizes FtsZ protofilament curvature (radius = 22 nm) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.