Recombinant Yersinia pestis Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type preference, please let us know, and we will prioritize development based on your specification.
Synonyms
lgt; YPDSF_1703; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAMLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS
Uniprot No.

Target Background

Function
Recombinant Yersinia pestis Prolipoprotein diacylglyceryl transferase (lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its role in Yersinia pestis?

Prolipoprotein diacylglyceryl transferase (lgt) is an essential enzyme in Yersinia pestis that catalyzes the transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate via the formation of a thioether bond . This process is critical for bacterial lipoprotein processing. In bacterial physiology, lgt facilitates the first step in lipoprotein maturation, attaching a diacylglyceryl moiety to a conserved cysteine residue in the lipobox motif of prolipoproteins. This modification is essential for membrane anchoring of various lipoproteins that play roles in nutrient acquisition, cell envelope integrity, and virulence factor expression in Y. pestis, the causative agent of plague .

What is the relationship between lgt and virulence in Yersinia pestis infection?

While the search results don't directly address the relationship between lgt and virulence in Y. pestis, general principles of bacterial pathogenesis suggest important connections. Prolipoprotein diacylglyceryl transferase facilitates proper processing of lipoproteins, many of which contribute to bacterial virulence. Y. pestis possesses several virulence factors, including the capsular protein F1 antigen and LcrV (V antigen) , which are critical for pathogenesis. Properly processed lipoproteins may interact with host Toll-like receptors (TLRs), particularly TLR2, potentially modulating host immune responses . The ability of Y. pestis to establish infection in mammals involves complex interactions with host immunity, and bacterial lipoproteins—processed by lgt—likely play roles in these interactions. Further research specifically investigating lgt-dependent lipoproteins and their contributions to Y. pestis virulence would be valuable for understanding plague pathogenesis.

What purification methods yield the highest activity for recombinant Y. pestis lgt?

While the search results don't detail optimization of Y. pestis lgt purification specifically, information from related research suggests a multi-step purification approach:

  • Initial capture using Ni-nitrilotriacetic acid (Ni-NTA) column chromatography, exploiting His-tag affinity

  • Further purification through gel filtration chromatography to separate different oligomeric states of the protein

The search results indicate that recombinant proteins from Y. pestis can exist in different multimeric states that may have different biological activities. For example, with LcrV protein, only high-molecular-weight multimers demonstrated TLR2 stimulating activity, while dimer and tetramer forms (which constituted the bulk of the material) lacked this activity . This suggests that when purifying recombinant Y. pestis lgt, researchers should:

  • Monitor both protein purity and oligomeric state

  • Assess enzymatic activity across different fractions

  • Consider additional purification steps such as ion exchange chromatography if needed

Storage recommendations include keeping the purified protein in a Tris-based buffer with 50% glycerol, and avoiding repeated freeze-thaw cycles by storing working aliquots at 4°C for up to one week .

How can researchers effectively measure the enzymatic activity of recombinant Y. pestis lgt?

Based on information from related research on bacterial lgt enzymes, enzymatic activity can be measured by tracking the release of glycerol phosphate, a by-product of the lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate . A specific methodology described in the search results includes:

  • Using a peptide substrate derived from a bacterial lipoprotein containing the conserved cysteine that is modified by lgt

  • Measuring the release of glycerol phosphate through a coupled luciferase reaction

It's important to note that when using phosphatidylglycerol containing a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) may be released as Lgt catalyzes the reaction .

The enzymatic reaction can be represented as:

Phosphatidylglycerol+ProlipoproteinlgtDiacylglyceryl-prolipoprotein+Glycerol phosphate\text{Phosphatidylglycerol} + \text{Prolipoprotein} \xrightarrow{\text{lgt}} \text{Diacylglyceryl-prolipoprotein} + \text{Glycerol phosphate}

Researchers should consider including appropriate controls (heat-inactivated enzyme, reaction without substrate) and optimizing reaction conditions (pH, temperature, divalent cation concentration) for maximal activity assessment.

How does the multimeric state of recombinant Y. pestis lgt affect its activity and interactions?

The recombinant F1 antigen (rF1) exists as a multimer of high molecular mass that can be dissociated by heating in the presence of SDS and reassociates upon SDS removal . Importantly, mice immunized with multimeric rF1 showed significantly better protection against Y. pestis challenge compared to those immunized with monomeric rF1 (5/7 survival vs. 1/7 survival) . This suggests that the multimeric state can be crucial for biological activity.

Similarly, with LcrV protein, only high-molecular-weight multimers or aggregates demonstrated TLR2 stimulating activity, while dimer and tetramer forms lacked this activity despite constituting the bulk of the purified material .

These findings suggest that for recombinant Y. pestis lgt:

  • The protein may exist in different oligomeric states

  • Different oligomeric forms might have distinct enzymatic properties or substrate interactions

  • Careful characterization of oligomeric state during purification and activity assays is warranted

  • Methods like circular dichroism, which has been used to monitor reassociation of monomeric proteins into multimeric forms , could be valuable for studying lgt oligomerization

What is the structural basis for substrate recognition by Y. pestis lgt?

While the search results don't provide specific structural information about Y. pestis lgt, understanding of the enzyme's function can be inferred from general mechanisms of bacterial lgt enzymes. The lgt enzyme recognizes specific sequence motifs in prolipoproteins, particularly the "lipobox" that contains a conserved cysteine residue that becomes the site of diacylglyceryl attachment .

From the amino acid sequence provided for Y. pestis lgt , structural predictions could include:

  • Multiple transmembrane domains, suggested by the hydrophobic amino acid clusters in the sequence

  • Potential active site residues involved in catalysis

  • Regions involved in binding phosphatidylglycerol substrate

For comprehensive structural understanding, researchers should consider:

  • Conducting X-ray crystallography or cryo-EM studies of the purified protein

  • Performing site-directed mutagenesis to identify critical residues for substrate binding and catalysis

  • Using computational approaches to model the enzyme structure and substrate docking

  • Comparing the Y. pestis lgt sequence with structural data from other bacterial species where available

How does inhibition of lgt affect Y. pestis growth and virulence?

  • Testing whether G2824 and similar compounds inhibit Y. pestis lgt enzymatic activity in vitro

  • Examining effects of lgt inhibitors on Y. pestis growth in culture

  • Investigating how lgt inhibition affects expression of virulence factors

  • Assessing impacts on bacterial survival in macrophages or other relevant host cell types

  • Evaluating effects on virulence in appropriate animal models

Given that proper lipoprotein processing is often essential for bacterial growth and virulence, lgt inhibition could potentially:

  • Disrupt cell envelope integrity

  • Impair nutrient acquisition systems

  • Reduce expression or function of key virulence factors

  • Alter host-pathogen interactions, particularly with innate immune receptors

  • Attenuate bacterial survival and replication in vivo

How conserved is lgt across Yersinia species and other pathogenic bacteria?

While the search results don't provide a direct comparison of lgt across bacterial species, the enzyme appears to be functionally conserved across Gram-negative bacteria. Studies on both Y. pestis lgt and E. coli lgt indicate similar enzymatic functions involving the transfer of diacylglyceryl from phosphatidylglycerol to prolipoprotein substrates.

The Y. pestis strain Pestoides F lgt sequence is documented , allowing for comparative genomic analyses. Researchers investigating lgt conservation should consider:

  • Performing sequence alignments of lgt from different Yersinia species (Y. pestis, Y. pseudotuberculosis, Y. enterocolitica)

  • Comparing lgt sequences across diverse Gram-negative pathogens

  • Analyzing conservation of key functional domains and catalytic residues

  • Investigating lgt gene context within bacterial genomes to identify conserved gene neighborhoods

How does the enzymatic mechanism of Y. pestis lgt compare to lgt in other bacteria?

The basic enzymatic mechanism of lgt appears consistent across bacterial species, involving the transfer of diacylglyceryl from phosphatidylglycerol to a conserved cysteine residue in prolipoproteins . In E. coli, the reaction generates glycerol phosphate as a by-product, which can be measured to assess enzymatic activity .

A comparison of lgt enzymatic characteristics might include:

ParameterY. pestis lgtE. coli lgtOther bacterial lgt
Substrate specificityRecognizes lipobox-containing prolipoproteinsSimilar recognition of lipobox motifGenerally conserved but may have species-specific preferences
Inhibitor sensitivityUnknown from search resultsInhibited by G2824 Varies by species
Kinetic parametersNot provided in search resultsNot provided in search resultsWould vary by species
pH optimumNot provided in search resultsNot provided in search resultsTypically neutral to slightly alkaline
Temperature optimumNot provided in search resultsNot provided in search resultsLikely corresponds to optimal growth temperature

For comprehensive comparison, researchers should:

  • Express and purify lgt from multiple bacterial species

  • Conduct side-by-side enzymatic assays under identical conditions

  • Test cross-species substrate utilization

  • Evaluate inhibitor efficacy across different bacterial lgt enzymes

What role does lgt play in Y. pestis adaptation to different hosts and vectors?

Y. pestis has a complex life cycle involving mammalian hosts and flea vectors, with distinct environments requiring specific adaptations . While the search results don't directly address lgt's role in this adaptation, several considerations emerge:

  • Properly processed lipoproteins may be important for survival in both mammalian hosts and arthropod vectors

  • Temperature-dependent regulation of lgt activity might facilitate adaptation between the flea vector (ambient temperature) and mammalian host (37°C)

  • Lipoproteins processed by lgt could participate in immune evasion strategies

The natural history of plague involves:

  • Transmission by flea bites, with bacteria entering the host through the skin

  • Development of bubonic plague characterized by painful, enlarged lymph nodes (buboes)

  • Potential progression to septicemic or pneumonic forms

  • Environmental persistence involving rodent reservoirs and flea vectors

Researchers investigating lgt's role in this complex lifecycle might:

  • Compare lgt expression and activity at different temperatures (flea vs. mammalian host)

  • Examine how lgt-dependent lipoprotein processing affects interactions with innate immune receptors

  • Investigate whether lgt function affects transmission efficiency between hosts and vectors

  • Assess whether lgt activity contributes to bacterial persistence in different environments

What are promising approaches for developing lgt inhibitors as potential therapeutics against Y. pestis?

Based on findings that inhibitor G2824 blocks E. coli Lgt activity and inhibits bacterial growth , similar approaches could be applied to Y. pestis lgt. Potential research strategies include:

  • High-throughput screening of chemical libraries for Y. pestis lgt inhibitors

  • Structure-based drug design targeting the lgt active site

  • Evaluation of G2824 and derivatives against Y. pestis lgt

  • Development of peptidomimetics that compete with natural substrates

  • Testing of natural products with potential lgt inhibitory activity

Researchers should consider:

  • Establishing robust in vitro assays for Y. pestis lgt activity

  • Developing cell-based screens to identify compounds with whole-cell activity

  • Assessing inhibitor specificity across bacterial and human enzymes

  • Evaluating pharmacokinetic and pharmacodynamic properties of promising candidates

  • Testing efficacy in relevant animal models of Y. pestis infection

How might recombinant Y. pestis lgt contribute to vaccine development strategies?

While lgt itself hasn't been established as a vaccine antigen based on the search results, insights from other Y. pestis immunogens like the F1 antigen and LcrV suggest potential approaches:

  • Recombinant F1, particularly in its multimeric form, provides significant protection against Y. pestis challenge in mice

  • LcrV (V antigen) is one of only two proteins that serve as highly effective vaccine antigens against Y. pestis

For potential lgt-related vaccine strategies, researchers might:

  • Investigate whether lgt-processed lipoproteins could serve as vaccine antigens

  • Explore whether lgt itself, particularly surface-exposed domains, could elicit protective immune responses

  • Develop attenuated Y. pestis strains with modified lgt activity that maintain immunogenicity

  • Consider lgt inhibition as an adjunct to other vaccine approaches

The established correlation between multimeric state and protective efficacy for F1 antigen suggests that attention to protein conformation would be important in any lgt-based vaccine approach.

What techniques can improve the stability and activity of recombinant Y. pestis lgt for structural studies?

Advanced structural studies of membrane proteins like lgt present significant challenges. Based on general principles and information from the search results about other Y. pestis proteins, researchers might consider:

  • Optimization of expression constructs

    • Testing different affinity tags and their positions

    • Creating truncated constructs focusing on specific domains

    • Engineering stabilizing mutations

  • Detergent and lipid optimization

    • Screening various detergents for extraction and purification

    • Incorporating native or synthetic lipids to maintain the native environment

    • Exploring nanodiscs or liposome reconstitution

  • Stabilization strategies

    • Using ligands or inhibitors during purification to stabilize specific conformations

    • Employing protein engineering to reduce flexible regions

    • Testing different buffer compositions and additives

  • Advanced purification approaches

    • Implementing tandem purification strategies

    • Using size-exclusion chromatography to isolate specific oligomeric states

    • Applying affinity-based methods to isolate functionally active protein

The search results indicate that recombinant Y. pestis proteins can be stored in Tris-based buffer with 50% glycerol , but structural studies would require optimization of conditions that maintain native folding while allowing for crystallization or cryo-EM analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.