Recombinant Yersinia pestis Rhomboid protease glpG (glpG)

Shipped with Ice Packs
In Stock

Description

Introduction to Yersinia pestis and Rhomboid Proteases

Yersinia pestis stands as one of history's most notorious pathogens, responsible for devastating plague pandemics including the infamous Black Death of medieval Europe. This gram-negative bacterium has evolved sophisticated virulence mechanisms that enable it to overcome host immune defenses and establish deadly infections. Modern phylogenetic analysis has classified Y. pestis into seven subspecies: pestis, caucasica (0.PE2), angolica (0.PE3), central asiatica (0.PE4), tibetica (0.PE7), ulegeica (0.PE5), and qinghaica (0.PE10), reflecting its evolutionary diversity and geographical distribution .

Y. pestis employs an impressive arsenal of virulence factors that collectively suppress host immune responses and facilitate bacterial survival. These include the Yersinia outer protein H (YopH), a protein tyrosine phosphatase essential for virulence , and the Pla protease that degrades host Fas ligand to prevent apoptosis and inflammation . Additionally, Y. pestis has acquired E3 ligases YspE1 and YspE2 that target host guanylate-binding proteins for degradation, a capability not present in its evolutionary ancestor Y. pseudotuberculosis .

Within this context of sophisticated virulence strategies, rhomboid proteases like glpG represent another potentially important component of the bacterial machinery. Rhomboid proteases constitute a family of intramembrane serine proteases found across all domains of life, typically involved in regulatory processes through the controlled proteolytic cleavage of substrate proteins within their transmembrane domains.

Functional Significance in Y. pestis Biology

While the specific functions of glpG in Y. pestis remain to be fully characterized, insights can be drawn from the roles of other proteases in this pathogen's virulence strategies. Proteolytic enzymes play critical roles in Y. pestis pathogenesis through various mechanisms:

The Pla protease represents one of the best-studied Y. pestis proteases. Research has demonstrated that Pla degrades host Fas ligand (FasL), preventing downstream caspase-3/7 activation and reducing apoptosis in infected cells . This mechanism contributes to the manipulation of host inflammatory responses and facilitates bacterial survival. In experimental models, deletion of the pla gene results in altered levels of FasL and caspase activity in infected tissues, highlighting the importance of this proteolytic activity in pathogenesis .

Y. pestis has also evolved mechanisms to manipulate host protein degradation systems through acquired E3 ligase activity. The YspE1 and YspE2 proteins can be delivered into host cells via the type III secretion system, where they ubiquitinate multiple guanylate-binding proteins (GBPs) for proteasomal degradation . This capability appears to be a newly acquired feature during Y. pestis evolution from Y. pseudotuberculosis, suggesting that proteolytic control of host defense mechanisms represents an important evolutionary adaptation in plague pathogenesis .

Post-translational Modifications and Protein Interactions

Research on Y. pestis virulence factors has revealed sophisticated mechanisms of post-translational modification that affect protein function and host interactions. While not specifically documented for glpG, these findings illustrate the complexity of protein regulation in this pathogen.

For example, the Y. pestis LcrV protein, which caps the type III secretion apparatus, undergoes glutathionylation at cysteine 273 . This modification, involving the formation of reversible mixed disulfides between glutathione and protein cysteine residues, promotes association with host ribosomal protein S3 (RPS3) and moderates the transport of type III effectors and macrophage killing . Experimental mutation of the cysteine residue abolished this modification and attenuated virulence in animal models, demonstrating the functional significance of this post-translational regulation .

Such findings highlight the importance of studying not only the primary sequence and structure of virulence-associated proteins like glpG, but also their potential modifications and interactions within the context of host infection.

Applications in Research and Therapeutic Development

Recombinant Y. pestis Rhomboid protease glpG serves multiple purposes in research settings:

Drug Discovery Applications

If glpG contributes to Y. pestis virulence or survival, it could represent a potential target for novel anti-plague therapeutics. The commercially available recombinant protein facilitates screening of potential inhibitors and structure-based drug design efforts.

Comparative Analysis with Other Bacterial Pathogens

Rhomboid proteases are found across diverse bacterial species, and comparative studies can provide evolutionary insights into their acquisition and functional adaptation. The example of Y. pestis acquiring novel E3 ligase functions not present in Y. pseudotuberculosis demonstrates how such evolutionary comparisons can reveal important virulence mechanisms .

Table 2: Potential Research Applications for Recombinant Y. pestis Rhomboid protease glpG

Application CategorySpecific ApproachesPotential Insights
Enzymatic CharacterizationSubstrate identification, kinetic analysisBiological function and regulation
Structural BiologyX-ray crystallography, cryo-EMCatalytic mechanism, inhibitor design
Immunological StudiesAntibody development, immune recognitionDiagnostic applications, vaccine research
Drug DiscoveryHigh-throughput screening, rational designNovel anti-plague therapeutics
Comparative GenomicsCross-species analysisEvolutionary significance, virulence adaptation

Context Within Y. pestis Virulence Mechanisms

The study of glpG must be considered within the broader context of Y. pestis virulence strategies. This pathogen has evolved multiple mechanisms to manipulate host defenses, particularly targeting innate immune responses that represent the first line of defense against bacterial infection.

Y. pestis initially survives within macrophages after host invasion but subsequently develops resistance to phagocytosis through the expression of multiple virulence factors . This transition from intracellular to extracellular lifestyle represents a critical step in establishing systemic infection. The bacterium employs various strategies to accomplish this, including the type III secretion system that injects effector proteins directly into host cells, anti-phagocytic surface proteins, and modified lipopolysaccharide structures that evade immune recognition .

Proteolytic enzymes play key roles in these processes. For example, the YopK protein induces macrophage apoptosis early in infection, while YopM inhibits caspase-1 activation to prevent pyroptosis, a form of inflammatory cell death . These mechanisms collectively suppress initial inflammatory responses, creating a permissive environment for bacterial replication.

The potential contribution of glpG to these processes remains to be fully elucidated, but its conservation within the Y. pestis genome suggests functional significance. Investigation of this rhomboid protease may reveal additional dimensions of the sophisticated host-pathogen interactions that characterize plague pathogenesis.

Future Research Directions

Several promising research avenues could expand our understanding of Y. pestis Rhomboid protease glpG:

  1. Genetic knockout studies to determine the effects of glpG deletion on bacterial physiology and virulence

  2. Identification of natural substrates using proteomics approaches

  3. Structural determination through crystallography or cryo-electron microscopy

  4. Development of specific inhibitors as research tools and potential therapeutic leads

  5. Investigation of expression patterns during different stages of infection

  6. Comparative analysis across Y. pestis subspecies and related Yersinia species

Such studies would contribute to our fundamental understanding of bacterial rhomboid proteases while potentially revealing new aspects of plague pathogenesis and identifying novel targets for therapeutic intervention.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be selected during the production process. If you have a preference for a particular tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
glpG; YPDSF_0049; Rhomboid protease GlpG; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
glpG
Target Protein Sequence
MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQLSAVQHELEQFLLDP LNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVLCIAIYILMLITGDMAV MSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLGGQMEKRLGTSKLLVLTI VSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPERGISLPRGLMAFSVLWLIA GYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ
Uniprot No.

Target Background

Function
Rhomboid-type serine protease that catalyzes intramembrane proteolysis.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pestis Rhomboid protease glpG and what is its significance in pathogenesis?

Yersinia pestis Rhomboid protease glpG is an intramembrane protease that belongs to the rhomboid family of serine proteases. These proteases play crucial roles in various cellular processes including protein quality control and signal transduction. In the context of Y. pestis pathogenesis, membrane proteases contribute to bacterial survival mechanisms, though the specific roles of glpG are still being elucidated.

The structural characteristics of GlpG include six transmembrane helices connected by five loops, with the first loop (L1) being notably large and containing several small interfacial helices . The protein has distinct N-terminal and C-terminal domains that fold semi-independently, providing insight into its functional mechanisms .

How does glpG differ structurally from other rhomboid proteases?

GlpG from Yersinia pestis exhibits the core structural elements common to rhomboid proteases but with species-specific variations. Based on computational modeling and crystallography studies, GlpG possesses a six transmembrane helix structure with specific helix-helix interactions mediated by small and polar residues that provide stability in the membrane environment .

Unlike some other rhomboid proteases, the Y. pestis GlpG has evolved structural features that may be specifically adapted to function optimally in the environmental conditions encountered during the pathogen's lifecycle, including temperature fluctuations between flea vectors and mammalian hosts.

What expression systems are most effective for producing recombinant Y. pestis glpG?

For laboratory-scale production of recombinant Y. pestis glpG, both prokaryotic and eukaryotic expression systems have been employed, with E. coli being the most commonly used system due to its ease of genetic manipulation and rapid growth. When expressing membrane proteins like glpG, several considerations must be addressed:

  • Use of specialized E. coli strains (C41, C43) designed for membrane protein expression

  • Incorporation of fusion tags that enhance protein solubility and facilitate purification

  • Controlled expression conditions with lower temperatures (16-25°C) and reduced inducer concentrations

  • Addition of specific detergents for solubilization and purification

For functional studies, insect cell expression systems may provide better protein folding and post-translational modifications compared to bacterial systems.

What computational approaches are most effective for modeling the membrane topology of glpG?

Computational modeling of glpG membrane topology requires specialized approaches due to its intramembrane nature. Molecular dynamics simulations using coarse-grained structure-based models have proven effective, as demonstrated in studies of GlpG . The methodology includes:

  • Development of models based on crystallographic data (such as PDB ID 2XOV for structural homologs)

  • Implementation of implicit membrane models that distinguish between intramembrane and extramembrane residues

  • Sampling at multiple temperatures with umbrella sampling to analyze various folding states

  • Application of the Multistate Bennett Acceptance Ratio (MBAR) method to reconstruct unbiased free-energy profiles

These computational approaches allow researchers to predict protein behavior in membrane environments that are difficult to study experimentally.

How can researchers effectively analyze the domain organization and folding mechanics of glpG?

Analysis of domain organization and folding mechanics of glpG requires a multi-faceted approach combining computational and experimental techniques:

MethodApplicationKey Parameters
Structure-based modelingIdentifies semi-independent folding domains6.5-Å Cβ–Cβ cutoff for native interactions
Selective strengthening of local interactionsDecouples secondary and tertiary structure formationModification of interaction strengths based on sequence proximity
Free-energy profilingMaps folding landscapesTemperature-dependent sampling with umbrella methods
Experimental validationConfirms computational predictionsCD spectroscopy, limited proteolysis, thermal denaturation

The combination of these approaches has revealed that glpG contains N-terminal and C-terminal domains that fold semi-independently, providing insight into the protein's stability and function .

What assays are most sensitive for measuring the proteolytic activity of recombinant glpG?

For measuring the proteolytic activity of recombinant glpG, several complementary assays can be employed:

  • Fluorogenic peptide substrate assays: Using custom-designed peptides containing a fluorophore and quencher separated by the protease cleavage sequence, allowing real-time kinetic monitoring

  • Mass spectrometry-based activity assays: Enabling identification of specific cleavage sites in substrate proteins

  • In vitro reconstitution systems: Incorporating purified glpG into artificial liposomes or nanodiscs to measure activity in a membrane-like environment

  • Cell-based reporter assays: Employing substrate proteins fused to reporters like GFP to monitor cleavage events in cellular contexts

Each assay provides different information about enzyme activity, and combining multiple approaches allows comprehensive characterization of proteolytic function.

How does the membrane environment affect glpG activity and what methods best simulate native conditions?

The membrane environment critically influences glpG activity as an intramembrane protease. To effectively simulate native conditions, researchers should consider:

  • Lipid composition: The bacterial membrane contains specific phospholipids that affect enzyme orientation and activity

  • Membrane thickness: Influences the positioning of transmembrane helices and active site accessibility

  • Lateral pressure profile: Affects protein conformation and substrate accessibility

Methodologies to recreate these conditions include:

  • Reconstitution in liposomes with defined lipid compositions

  • Use of nanodiscs with controlled size and lipid content

  • Incorporation into bicelles or amphipols for structural studies

  • Detergent micelles with properties mimicking the native membrane

Studies have shown that membrane protein stability, including rhomboid proteases like glpG, depends on tight helix-helix interactions mediated by small and polar residues , emphasizing the importance of appropriate membrane mimetics.

What strategies can overcome the challenges of expressing and purifying functional recombinant glpG?

Expression and purification of functional recombinant glpG presents several challenges that can be addressed with the following strategies:

ChallengeSolution StrategyImplementation Details
Low expression yieldsCodon optimizationAdapting codons to the expression host preferences
Fusion tagsAddition of MBP, SUMO, or other solubility-enhancing tags
Specialized expression strainsUse of C41(DE3), C43(DE3) designed for membrane proteins
Protein misfoldingTemperature modulationExpression at 16-20°C to slow folding and improve quality
Chaperon co-expressionAddition of plasmids expressing GroEL/GroES or DnaK/DnaJ/GrpE
Extraction from membranesDetergent screeningSystematic testing of detergents (DDM, LDAO, FC-12)
Native nanodiscsDirect extraction into scaffold protein-bounded lipid discs
Maintaining activityLipid supplementationAddition of specific phospholipids during purification
Limited exposure to harsh conditionsGentle purification protocols with minimal temperature fluctuations

Implementing these strategies can significantly improve the yield of functional protein for subsequent structural and biochemical studies.

How can researchers effectively design substrate specificity studies for Y. pestis glpG?

Designing substrate specificity studies for Y. pestis glpG requires a systematic approach to identify physiological substrates and determine cleavage preferences:

  • Bioinformatic prediction: Analysis of potential substrates based on sequence motifs found in known rhomboid protease substrates

  • Proteomics approaches:

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify N-termini generated by proteolytic cleavage

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with quantitative proteomics

  • Peptide library screening:

    • Positional scanning libraries to determine preferred amino acids at each position

    • Synthetic peptide arrays with systematic mutations around putative cleavage sites

  • Cell-based validation:

    • Co-expression of glpG with candidate substrates

    • Monitoring substrate cleavage in cellular contexts

Data from these approaches should be integrated to develop a comprehensive model of substrate recognition and specificity.

How can recombinant Y. pestis glpG be utilized in drug discovery platforms targeting bacterial virulence?

Recombinant Y. pestis glpG represents a potential target for novel antimicrobial therapies. Researchers can leverage this protein in drug discovery through:

  • High-throughput screening platforms:

    • Fluorescence-based activity assays adapted to 384 or 1536-well formats

    • Fragment-based screening using thermal shift assays or surface plasmon resonance

    • Virtual screening against the active site or allosteric pockets

  • Structure-guided drug design:

    • Utilizing computational models based on crystal structures

    • Molecular docking of compound libraries

    • Optimization of lead compounds through medicinal chemistry

  • Phenotypic validation:

    • Testing compounds in Y. pestis infection models

    • Evaluation of virulence attenuation in fluorescent Y. pestis strains

    • Assessment of compound effects on bacterial fitness

Given the increasing concern about antimicrobial resistance in Y. pestis , targeting non-essential virulence factors like proteases offers an alternative approach that may reduce selective pressure for resistance development.

What are the most informative approaches for studying glpG's role in Y. pestis pathogenesis?

To elucidate glpG's role in Y. pestis pathogenesis, researchers should employ multi-faceted approaches:

  • Genetic manipulation:

    • Construction of glpG deletion mutants

    • Complementation studies with wild-type and catalytically inactive variants

    • CRISPR interference for conditional knockdown

  • Infection models:

    • Macrophage infection assays to assess intracellular survival

    • Fluorescent protein-expressing strains for tracking bacterial dissemination

    • Animal infection models with wildtype and glpG mutants

  • Transcriptomic and proteomic profiling:

    • RNA-seq to identify genes differentially regulated in glpG mutants

    • Comparative proteomics to identify changes in protein expression

    • Phosphoproteomics to identify altered signaling pathways

  • Host-pathogen interaction studies:

    • Co-culture with protozoa (like Acanthamoeba castellani)

    • Assessment of survival in different environmental conditions

    • Investigation of biofilm formation and flea gut colonization

These approaches can reveal whether glpG contributes to specific aspects of Y. pestis pathogenesis, such as immune evasion, intracellular survival, or host adaptation.

How can researchers distinguish between direct and indirect effects when analyzing glpG knockout phenotypes?

Distinguishing direct from indirect effects in glpG knockout studies requires a systematic approach:

  • Complementation analysis:

    • Reintroduction of wild-type glpG should restore the wild-type phenotype

    • Introduction of catalytically inactive glpG (with active site mutations) should not restore function if proteolytic activity is required

    • Domain-specific variants can identify which protein regions mediate specific functions

  • Temporal analysis:

    • Time-course experiments can differentiate primary (early) from secondary (late) effects

    • Inducible expression systems allow for precise timing of glpG expression/repression

  • Multi-omics integration:

    • Correlation of transcriptomic, proteomic, and metabolomic data to identify affected pathways

    • Network analysis to map direct protein-protein interactions versus downstream effects

  • Substrate validation:

    • Direct biochemical confirmation of substrate cleavage in vitro

    • Site-directed mutagenesis of putative cleavage sites in candidate substrates

These methodologies help build a causal model that separates direct glpG functions from secondary adaptations to its absence.

What statistical approaches are most appropriate for analyzing structural dynamics data from glpG simulations?

Analysis of structural dynamics data from glpG simulations requires specialized statistical approaches:

When applying these methods to membrane proteins like glpG, special consideration must be given to the membrane environment, which constrains protein motion differently than aqueous environments. For instance, computational models that incorporate implicit membrane representations allow for proper analysis of membrane protein dynamics .

How might novel biotechnological applications emerge from engineered variants of Y. pestis glpG?

Engineered variants of Y. pestis glpG have potential applications in several biotechnological fields:

  • Biosensors and diagnostics:

    • Development of protease-based biosensors for detecting specific biological molecules

    • Creating reporter systems where proteolytic activity triggers signal amplification

  • Synthetic biology tools:

    • Engineered proteases with modified substrate specificity for controlled protein processing

    • Development of orthogonal signaling systems using modified rhomboid proteases

  • Protein engineering platforms:

    • Using knowledge of glpG folding and stability to improve membrane protein expression

    • Development of protein scaffolds for membrane protein crystallization

  • Therapeutic applications:

    • Engineered proteases for targeted degradation of pathological protein aggregates

    • Development of immunomodulatory proteins based on modified bacterial proteases

These applications require detailed understanding of glpG structure-function relationships, which can be obtained through the computational modeling approaches described in previous sections .

What emerging technologies might advance our understanding of glpG function in bacterial membranes?

Several emerging technologies hold promise for advancing our understanding of glpG function:

  • Cryo-electron tomography:

    • Visualization of membrane proteins in their native cellular context

    • Structural determination without protein extraction or crystallization

  • Advanced single-molecule techniques:

    • Single-molecule FRET to measure conformational changes during catalysis

    • Force spectroscopy to assess protein stability and unfolding pathways

  • Integrative structural biology:

    • Combining multiple data sources (crystallography, NMR, simulations) for complete models

    • Development of specialized force fields for membrane protein simulations

  • AI-driven protein structure prediction:

    • Application of AlphaFold or similar algorithms to predict membrane protein structures

    • Machine learning approaches to identify functional motifs and predict substrate specificity

  • Genome-wide screening technologies:

    • CRISPR-based screens to identify genetic interactions with glpG

    • High-throughput mutagenesis to map functional residues

These technologies can overcome current limitations in studying membrane proteins and provide unprecedented insights into glpG function within the complex bacterial membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.