Recombinant Yersinia pestis Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Spermidine Excretion Mechanism

  • SMR Family Transporter: MdtJ belongs to the SMR family, which mediates efflux of toxic compounds, including polyamines .

  • Spermidine Toxicity Alleviation: In E. coli, MdtJI reduces intracellular spermidine levels, preventing growth inhibition caused by polyamine overaccumulation .

  • Regulation: Spermidine induces mdtJI mRNA expression in E. coli, suggesting feedback regulation .

Relevance to Yersinia pestis

While Yersinia MdtJ’s role is not explicitly studied, its conservation across pathogens implies analogous functions:

  • Polyamine Homeostasis: Maintaining optimal spermidine levels for DNA stabilization and protein synthesis.

  • Antimicrobial Resistance: Potential role in extruding toxic compounds, though direct evidence in Yersinia is lacking.

Production and Experimental Applications

The recombinant MdtJ is commercially available in lyophilized form, optimized for research use:

ParameterDetails
Expression HostE. coli
Purity Assurance>90% (SDS-PAGE confirmed)
Storage Stability-20°C/-80°C (long-term); 4°C for short-term aliquots
ReconstitutionSterile water with 5–50% glycerol (final concentration)

Experimental Uses:

  • Polyamine Transport Studies: Investigating spermidine efflux mechanisms in gram-negative bacteria.

  • Vaccine Development: Potential inclusion in multi-antigen formulations (e.g., fusion proteins for broad-spectrum immunity) .

  • Structural Biology: Crystallography or cryo-EM studies to elucidate SMR transporter architecture.

Key Observations

  1. E. coli Biofilm Studies: Deletion of mdtJ in E. coli did not affect biofilm formation, suggesting compensatory mechanisms for polyamine regulation .

  2. Homology to Drug Exporters: MdtJ’s SMR classification implies potential cross-reactivity with antimicrobial agents, though unexplored in Yersinia.

  3. T3SS Interactions: While Yersinia T3SS components like YopN interact with regulators (e.g., YpCD1.09) , no direct link to MdtJ has been identified.

Gaps in Knowledge

  • Yersinia-Specific Data: No studies directly link MdtJ to virulence or pathogenicity in Yersinia pestis.

  • Structural Insights: Crystal structures or functional assays for Yersinia MdtJ remain unpublished.

**Comparative Analysis of MdtJ Across Yersinia Strains

Recombinant MdtJ variants from different Yersinia subspecies (e.g., bv. Antiqua) share identical amino acid sequences but differ in strain-specific annotations:

StrainUniProt IDLocus TagSource
Yersinia pestis (Pestoides F)A4TJJ0YPDSF_1054
Yersinia pestis bv. AntiquaA9QYW2YpAngola_A2409

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; YPDSF_1054; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNCHRGNRPP SVQELKTQTTGHHKGVAVESGEHHAAA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MdtJ and what is its function in bacterial cells?

MdtJ is a membrane protein that belongs to the small multidrug resistance (SMR) family of drug exporters. In bacterial cells, MdtJ forms a complex with MdtI (referred to as the MdtJI complex) that functions primarily as a spermidine excretion system. This complex plays a crucial role in polyamine homeostasis by catalyzing the excretion of spermidine from cells, which is essential when spermidine accumulates to potentially toxic levels. The protein has been well-characterized in Escherichia coli, with homologous systems predicted in other bacteria including Yersinia pestis .

How does the MdtJI complex contribute to bacterial survival?

The MdtJI complex enhances bacterial cell viability and growth through the excretion of spermidine when it overaccumulates in cells. Studies in E. coli have demonstrated that expression of mdtJI genes can rescue cell growth that would otherwise be significantly inhibited by high concentrations of spermidine (12 mM). This protective effect occurs because the MdtJI complex reduces the intracellular accumulation of spermidine to non-toxic levels by facilitating its export from the cell .

What is the relationship between MdtJ and MdtI proteins?

MdtJ and MdtI function as a heterodimeric complex rather than as independent proteins. Experimental evidence indicates that both mdtJ and mdtI genes are necessary for recovery from spermidine toxicity, suggesting a cooperative function. Neither protein alone is sufficient to create a functional spermidine export system. The proteins likely form a structural complex in the bacterial membrane that creates a channel or pore specifically designed for spermidine transport .

What are the most effective methods for recombinant expression of MdtJ from Yersinia pestis?

Recombinant expression of MdtJ typically utilizes standard molecular cloning techniques with some modifications for membrane proteins. The process generally involves:

  • PCR amplification of the mdtJ gene from Y. pestis genomic DNA

  • Insertion into appropriate expression vectors (such as pUC or pMW vectors)

  • Transformation into expression hosts (commonly E. coli strains)

  • Induction of protein expression

  • Membrane fraction isolation and protein purification

For optimal expression, vectors with strong inducible promoters like pUC provide higher expression levels than low-copy-number vectors like pMW, which may be preferable for functional studies. When expressing membrane proteins like MdtJ, consideration must be given to potential toxicity issues due to membrane insertion .

What purification strategies are most effective for isolating recombinant MdtJ protein?

Purification of recombinant MdtJ requires specialized approaches due to its membrane-embedded nature:

  • Cell lysis followed by differential centrifugation to isolate membrane fractions

  • Solubilization of membrane proteins using appropriate detergents

  • Affinity chromatography (if using tagged versions of the protein)

  • Size exclusion chromatography to isolate the MdtJI complex

For structural studies, techniques similar to those used for other membrane proteins may be applied, such as ammonium sulfate fractionation followed by FPLC (Fast Protein Liquid Chromatography) gel filtration, which has been successfully used for other Y. pestis recombinant proteins .

How can researchers assess the functional activity of recombinant MdtJ protein?

Functional assessment of recombinant MdtJ involves several complementary approaches:

  • Growth rescue assays: Transforming mdtJI genes into bacterial strains sensitive to spermidine toxicity and measuring growth recovery in the presence of high spermidine concentrations (e.g., 12 mM)

  • Spermidine content measurement: Quantifying intracellular spermidine levels in cells expressing or lacking MdtJI using techniques such as HPLC

  • Radioisotope transport assays: Monitoring excretion of [14C]spermidine from preloaded cells

  • Direct measurement of excreted spermidine: Analyzing polyamine levels in the extracellular medium after removing cells by centrifugation

These functional assays provide complementary data on the spermidine export activity of the MdtJI complex .

Which amino acid residues are critical for MdtJ function?

Specific amino acid residues in MdtJ have been identified as crucial for its spermidine export activity. In E. coli MdtJ, the following residues are particularly important:

  • Tyr 4

  • Trp 5

  • Glu 15

  • Tyr 45

  • Tyr 61

  • Glu 82

These residues likely contribute to substrate recognition, binding, or the formation of the transport channel. Mutations at these positions significantly impair the spermidine excretion activity of the MdtJI complex. The complementary residues in MdtI (Glu 5, Glu 19, Asp 60, Trp 68, and Trp 81) are also essential for proper function of the complex .

How does protein dynamics influence MdtJ function?

While specific research on MdtJ dynamics is limited in the provided sources, principles of protein dynamics relevant to membrane transporters suggest that MdtJ likely undergoes conformational changes during the transport cycle. General principles of membrane transporter dynamics include:

  • Alternating access mechanism where the protein alternates between inward-facing and outward-facing conformations

  • Substrate-induced conformational changes

  • Energy coupling to drive transport against concentration gradients

Understanding these dynamics requires techniques such as nuclear magnetic resonance (NMR), X-ray crystallography, single-molecule FRET, and computational simulations to visualize the protein in action. These approaches provide structural and energetic information about how the protein functions in the cellular environment3.

How conserved is MdtJ across different bacterial species, particularly between E. coli and Y. pestis?

The MdtJ protein belongs to the SMR family, which is widely distributed across bacterial species. While the search results do not provide direct sequence comparison between E. coli and Y. pestis MdtJ proteins, general principles of evolutionary conservation suggest:

  • Core functional domains involved in spermidine recognition and transport are likely highly conserved

  • Transmembrane regions generally show higher conservation than loop regions

  • Critical amino acid residues (such as those identified in E. coli MdtJ) are likely conserved in Y. pestis MdtJ

Comparative genomic analysis would be required to determine the exact degree of sequence identity and similarity between E. coli and Y. pestis MdtJ proteins. This information would help predict functional conservation and guide experimental approaches for studying Y. pestis MdtJ .

How does the function of MdtJ in Y. pestis compare to its role in other pathogenic bacteria?

  • Polyamine homeostasis is critical for bacterial survival under various stress conditions

  • Spermidine export systems like MdtJI may contribute to virulence by:

    • Protecting bacteria from toxic levels of polyamines encountered in host environments

    • Contributing to biofilm formation, which is important for Y. pestis virulence

    • Potentially modulating host immune responses

What are the implications of MdtJ function for Y. pestis virulence and pathogenesis?

Y. pestis, the causative agent of plague, produces various virulence factors that contribute to its extreme pathogenicity. While MdtJ's specific role in Y. pestis virulence is not directly established in the search results, polyamine transport systems generally contribute to bacterial stress responses and adaptation to host environments. Potential implications include:

  • Contribution to Y. pestis survival within macrophages or other host cells where polyamine levels may fluctuate

  • Possible role in biofilm formation, which is important for Y. pestis transmission by fleas

  • Potential involvement in managing oxidative stress during infection, as polyamines have antioxidant properties

Research examining mutants lacking functional MdtJ in Y. pestis infection models would help establish its significance in virulence .

Could MdtJ be a potential target for novel antimicrobial development?

Given the importance of polyamine homeostasis for bacterial survival, the MdtJI complex represents a potential target for antimicrobial development. Key considerations include:

  • Inhibitors targeting the MdtJI complex might sensitize Y. pestis to toxic levels of spermidine

  • Structural information about critical residues in MdtJ could guide rational drug design approaches

  • The conservation of MdtJ across bacterial species suggests broad-spectrum activity potential

  • Combination therapy approaches might target multiple polyamine transport systems simultaneously

Understanding the atomic-level structure and dynamics of MdtJ would be crucial for structure-based drug design efforts, similar to approaches that have been successful with other bacterial targets3 .

What are the major challenges in studying recombinant Y. pestis MdtJ protein?

Research on recombinant Y. pestis MdtJ faces several methodological challenges:

  • Biosafety concerns: Y. pestis is a Tier 1 Select Agent requiring specialized containment facilities

  • Membrane protein expression difficulties:

    • Toxicity during overexpression

    • Proper folding and insertion into membranes

    • Maintaining protein stability during purification

  • Functional reconstitution: Ensuring the recombinant protein retains native activity

  • Complex formation: MdtJ functions as part of a complex with MdtI, requiring co-expression strategies

These challenges can be addressed through careful optimization of expression systems, purification protocols, and functional assays specifically tailored to membrane proteins .

What experimental approaches can determine whether MdtJ multimers form in Y. pestis membranes?

Investigating the multimerization state of MdtJ in Y. pestis membranes requires specialized techniques:

  • Blue Native PAGE to analyze membrane protein complexes under non-denaturing conditions

  • Chemical cross-linking followed by SDS-PAGE to capture transient protein-protein interactions

  • FPLC gel filtration chromatography and capillary electrophoresis to determine complex molecular weight

  • Circular dichroism to monitor protein association and complex formation

  • Förster resonance energy transfer (FRET) between tagged versions of MdtJ and MdtI to detect direct interaction

These approaches have been successfully applied to study multimerization of other Y. pestis proteins, such as the F1 antigen, and could be adapted to investigate MdtJ complex formation 3.

How does spermidine concentration regulate mdtJI expression in Y. pestis?

Research in E. coli has shown that mdtJI mRNA levels increase in response to spermidine exposure, suggesting transcriptional regulation. For Y. pestis, key research questions include:

  • Do similar regulatory mechanisms exist in Y. pestis?

  • What transcription factors mediate spermidine-responsive regulation?

  • Are there Y. pestis-specific regulatory elements in the mdtJI promoter region?

  • How do environmental conditions encountered during infection affect mdtJI expression?

Experimental approaches to address these questions would include reporter gene assays, transcriptomic analysis under varying spermidine concentrations, and chromatin immunoprecipitation to identify transcription factor binding .

What is the relationship between MdtJ function and antibiotic resistance in Y. pestis?

As a member of the small multidrug resistance family, MdtJ may have broader substrate specificity beyond spermidine. Research questions at this frontier include:

  • Can the MdtJI complex export antibiotics in addition to spermidine?

  • Does overexpression of mdtJI confer resistance to specific antibiotics in Y. pestis?

  • Are there synergistic effects between antibiotics and spermidine due to competition for transport?

  • How does MdtJ activity compare with other drug efflux systems in Y. pestis?

Addressing these questions requires minimum inhibitory concentration (MIC) determination in strains with varying mdtJI expression levels, transport assays with radiolabeled antibiotics, and competition studies between spermidine and potential antibiotic substrates .

Key Amino Acid Residues in MdtJ Essential for Function

ProteinPositionAmino AcidPotential Role in Function
MdtJ4TyrosineSubstrate recognition/binding
MdtJ5TryptophanTransmembrane stabilization
MdtJ15Glutamic acidIonic interaction with spermidine
MdtJ45TyrosineTransport channel formation
MdtJ61TyrosineSubstrate specificity
MdtJ82Glutamic acidProton coupling mechanism

Note: Functional roles are inferred based on general properties of these amino acids and their common functions in membrane transporters .

Effect of MdtJI Expression on Spermidine Accumulation in E. coli

Experimental ConditionIntracellular Spermidine (nmol/mg protein)Intracellular Putrescine (nmol/mg protein)Cell Viability
No exogenous spermidine, vector control1.55.2High
2 mM exogenous spermidine, vector control12.45.4Reduced
2 mM exogenous spermidine + pUC mdtJI3.25.3Restored
12 mM exogenous spermidine, vector control>20~5Severely inhibited
12 mM exogenous spermidine + pUC mdtJI~5~5Significantly restored

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.