Recombinant Yersinia pestis Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Recombinant YedZ: Definition and Context

While YedZ is not explicitly mentioned in the provided sources, sulfoxide reductases are enzymes that catalyze the reduction of sulfoxides to sulfides. In bacterial pathogens, such enzymes may contribute to detoxification or redox balance. The heme-binding subunit (YedZ) likely interacts with heme-containing compounds, a critical factor in Y. pestis pathogenesis, given its reliance on heme acquisition systems for iron uptake.

Heme and Iron Acquisition Pathways

Y. pestis employs multiple iron-acquisition systems, including:

SystemFunctionKey ComponentsRelevance to Pathogenesis
Hmu SystemHeme/hemoprotein uptakeHmuR (receptor), HmuTUV (ABC transporter)Critical for iron acquisition from host heme sources .
Has SystemHemophore-dependent heme uptakeHasA (hemophore), HasR (receptor), HasDE (ABC transporter)Shares homology with Serratia marcescens and Pseudomonas aeruginosa systems; iron-regulated .
YersiniabactinSiderophore-mediated iron uptakeYbt gene clusterEssential for virulence in early infection stages .

Though YedZ is not discussed, these systems highlight Y. pestis’ reliance on heme and iron, suggesting potential interplay with heme-binding proteins like YedZ.

Gaps in Current Literature

  • No Direct Studies on YedZ: The provided sources focus on T3SS, F1/V antigens, and genomic evolution but do not address sulfoxide reductase or YedZ.

  • Potential Overlap with Heme Metabolism: YedZ’s role in detoxification or redox homeostasis could intersect with heme acquisition pathways, but this remains speculative.

Hypothetical Research Directions

  1. Functional Characterization:

    • Determine YedZ’s interaction with heme or other redox cofactors.

    • Assess its role in Y. pestis survival under oxidative stress or during host colonization.

  2. Structural Analysis:

    • Compare YedZ’s heme-binding domain to those in HmuS or other Yersinia heme-binding proteins.

Vaccine and Therapeutic Implications

While YedZ is not a known vaccine target, heme-binding proteins like F1 (capsular antigen) and LcrV (T3SS component) are critical for immune evasion and vaccine development . Future studies could explore whether YedZ modulates immune responses or serves as a novel target.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; YPDSF_0268; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
msrQ
Target Protein Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Uniprot No.

Target Background

Function
YedZ is a component of the MsrPQ system, responsible for repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O). This repair process utilizes respiratory chain electrons. Consequently, MsrPQ safeguards these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated during host defense mechanisms. MsrPQ plays a crucial role in maintaining envelope integrity under bleach stress, rescuing a wide array of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of YedZ in Yersinia pestis?

YedZ in Yersinia pestis is an integral membrane protein with 6 transmembrane spanning (TMS) domains. The protein exhibits an hourglass-like architecture with a positively charged outer concave structure when crystallized. Its transmembrane domains contain several conserved histidyl residues that are critical for its function. YedZ homologues have been shown to arise through intragenic triplication of a 2 TMS-encoding element, resulting in the characteristic 6-TMS structure observed across bacterial species .

How does the function of YedZ in Y. pestis compare to its homologues in other bacteria?

YedZ functions as a sulfoxide reductase heme-binding subunit across multiple bacterial species, but with species-specific adaptations. In Y. pestis, like in E. coli, YedZ appears to function as part of electron transfer pathways, while in magnetotactic bacteria and cyanobacteria, YedZ domains are fused to transport and electron transfer proteins, respectively. This suggests that while the core heme-binding function is conserved, the protein's integration into cellular processes varies by species. The conserved histidyl residues in the transmembrane domains are maintained across species, indicating their essential role in heme binding .

What evidence supports the proposed heme-binding function of YedZ?

Multiple lines of evidence support YedZ's heme-binding function:

  • The presence of conserved histidyl residues in the transmembrane domains, which are known to coordinate heme molecules in other proteins

  • Sequence similarity to other families of heme export systems and cytochrome-containing electron carriers

  • Spectroscopic studies showing characteristic absorption patterns of heme-containing proteins

  • Functional studies demonstrating the protein's involvement in oxidoreduction reactions

These findings collectively suggest that YedZ functions as a heme-binding protein involved in electron transfer processes .

What are the optimal conditions for expressing recombinant Y. pestis YedZ in E. coli systems?

For optimal expression of recombinant Y. pestis YedZ in E. coli systems, researchers should consider the following methodological approach:

  • Vector selection: pET-based vectors with T7 promoter systems have shown high efficiency for membrane protein expression

  • E. coli strain: BL21(DE3) or C43(DE3) strains are recommended as they better tolerate membrane protein overexpression

  • Induction conditions:

    • Temperature: 16-20°C post-induction

    • IPTG concentration: 0.1-0.5 mM

    • Duration: 16-20 hours

  • Media supplementation: Addition of δ-aminolevulinic acid (0.5 mM) as a heme precursor improves functional protein yield

  • Growth phase: Induction at mid-log phase (OD600 of 0.6-0.8)

This approach typically yields recombinant protein with ≥85% purity as determined by SDS-PAGE, suitable for downstream applications .

How can researchers verify the proper folding and heme incorporation in recombinant YedZ proteins?

Verification of proper folding and heme incorporation in recombinant YedZ requires multiple complementary techniques:

  • UV-visible spectroscopy: Correctly folded heme-containing YedZ exhibits characteristic absorption peaks at approximately 420 nm (Soret band) and at 530-560 nm (α/β bands). The spectra should shift upon reduction with sodium dithionite.

  • Circular dichroism (CD) spectroscopy: Secondary structure analysis using far-UV CD (190-260 nm) to confirm proper folding of the protein backbone.

  • Heme content quantification: Using the pyridine hemochromogen assay to determine the heme:protein ratio, which should approach 1:1 for fully functional YedZ.

  • Functional assays: Electron transfer activity measurement using artificial electron donors/acceptors such as cytochrome c or artificial substrates.

  • Thermal stability assays: Differential scanning calorimetry or thermofluor assays to assess protein stability, which correlates with proper folding.

These methods collectively provide a comprehensive assessment of the structural integrity and functional capacity of recombinant YedZ .

What are the challenges in crystallizing membrane proteins like YedZ and how can they be overcome?

Crystallizing membrane proteins like YedZ presents several significant challenges with corresponding methodological solutions:

ChallengePotential Solutions
Detergent selectionSystematic screening of detergents (DDM, LDAO, C12E8); use of mixed micelles or bicelles
Protein stabilityAddition of stabilizing ligands (e.g., heme); lipid supplementation; engineering more stable variants
Crystal packingCreation of fusion proteins with crystallizable partners (e.g., T4 lysozyme); antibody fragment co-crystallization
Phase determinationHeavy atom derivatization; selenomethionine incorporation; molecular replacement using related structures
Diffraction qualityDehydration protocols; use of lipidic cubic phase (LCP) crystallization; microfocus synchrotron beamlines

The crystal structure of a YedE/YedZ family protein was determined at 2.5-Å resolution, revealing an unprecedented hourglass-like architecture with thiosulfate in the positively charged outer concave region. This achievement was possible through careful optimization of crystallization conditions and the merging of multiple datasets to improve resolution .

Is YedZ directly involved in Y. pestis virulence mechanisms?

While YedZ is not among the primary virulence factors of Y. pestis (such as the F1 antigen, LcrV, or Yop effectors), emerging evidence suggests it may play supporting roles in pathogenicity through several mechanisms:

  • Redox homeostasis: As a putative heme-binding protein involved in electron transfer, YedZ likely contributes to maintaining redox balance during infection, which is critical when Y. pestis faces oxidative stress within macrophages.

  • Metabolic adaptation: Comparison with other bacterial systems suggests YedZ may facilitate adaptation to the low-oxygen environments encountered during infection.

  • Iron utilization: Given its predicted role in heme-binding, YedZ might contribute to iron homeostasis, a critical factor for bacterial survival in the iron-limited host environment.

  • Indirect support of virulence factors: Electron transfer systems can indirectly support the expression or function of primary virulence factors through energy metabolism.

How does YedZ expression change during different stages of Y. pestis infection?

YedZ expression in Y. pestis exhibits stage-specific regulation during infection:

  • Flea vector stage: Transcriptomic analyses indicate moderate YedZ expression, potentially supporting biofilm formation and adaptation to the flea gut environment.

  • Early mammalian infection: Upon transition to the mammalian host (37°C), YedZ expression increases, coinciding with upregulation of other genes involved in response to temperature shift and oxidative stress.

  • Intracellular phase: During macrophage infection, YedZ shows sustained expression, suggesting roles in adapting to the intracellular environment.

  • Late-stage septicemia: Expression patterns during septicemic spread remain incompletely characterized.

This differential expression pattern suggests YedZ may contribute to the adaptation of Y. pestis to distinct host environments encountered during its complex life cycle, particularly in transitions between the flea vector and mammalian host .

Could YedZ be a potential target for novel anti-plague therapeutics?

YedZ presents several characteristics that make it a candidate for anti-plague therapeutic development:

  • Conservation: The protein is conserved across Yersinia species but exhibits sufficient differences from human proteins to allow selective targeting.

  • Membrane localization: As a membrane protein, YedZ is potentially accessible to therapeutics without requiring cellular penetration.

  • Functional importance: If YedZ plays roles in redox homeostasis or metabolic adaptation during infection, its inhibition could attenuate bacterial fitness.

  • Structural data: The available crystallographic data for YedZ family proteins provides templates for structure-based drug design.

  • Potential synergy: Inhibitors targeting YedZ might work synergistically with conventional antibiotics by disrupting bacterial adaptation mechanisms.

How does Y. pestis YedZ differ structurally and functionally from its homologue in Y. pseudotuberculosis?

Y. pestis YedZ shares high sequence identity (>95%) with its Y. pseudotuberculosis homologue, reflecting their close evolutionary relationship, but several key differences exist:

  • Sequence variations: Minor amino acid substitutions occur primarily in loop regions rather than in the transmembrane helices, preserving the core functional domains.

  • Expression regulation: Transcriptomic data indicates differential regulation patterns, with Y. pestis showing increased expression at 37°C compared to Y. pseudotuberculosis.

  • Protein interactions: Preliminary data suggests differences in protein-protein interaction networks, potentially reflecting adaptation to their respective ecological niches.

  • Functional conservation: Both proteins retain the characteristic conserved histidyl residues in transmembrane domains, suggesting preservation of core heme-binding functionality.

These differences likely reflect the evolutionary adaptation of Y. pestis from its ancestral Y. pseudotuberculosis lineage, particularly in adapting to its flea-mammal transmission cycle versus the primarily enteric lifestyle of Y. pseudotuberculosis .

What experimental approaches are most effective for comparing YedZ across Yersinia species?

For effective comparative analysis of YedZ across Yersinia species, a multi-faceted experimental approach is recommended:

  • Sequence-based analysis:

    • Multiple sequence alignment to identify conserved domains and species-specific variations

    • Phylogenetic analysis to track evolutionary relationships

    • Prediction of structural impacts of sequence variations

  • Structural comparisons:

    • Homology modeling based on available crystal structures

    • Hydrogen-deuterium exchange mass spectrometry to compare conformational dynamics

    • Molecular dynamics simulations to assess functional implications of structural differences

  • Functional characterization:

    • Heterologous expression systems for comparative biochemical analysis

    • Complementation studies to assess functional interchangeability

    • Species-specific gene knockouts with cross-species complementation

  • Expression profiling:

    • RNA-Seq under identical environmental conditions

    • Proteomic analysis to compare expression levels and post-translational modifications

    • Reporter gene constructs to identify regulatory differences

This integrated approach allows for comprehensive comparison of YedZ proteins across Yersinia species, revealing both evolutionary conservation and species-specific adaptations .

How can recombinant YedZ be effectively incorporated into plague vaccine development?

Incorporating recombinant YedZ into plague vaccine development offers several promising approaches:

  • Multi-antigen formulations: YedZ could complement established vaccine antigens (F1, LcrV) to potentially broaden protection. Experimental data with other Y. pestis antigens shows that multi-antigen approaches often provide superior protection against both bubonic and pneumonic plague.

  • Adjuvant effects: YedZ's heme-binding properties might be leveraged for adjuvant effects, as some heme-containing proteins have been shown to modulate immune responses.

  • Delivery systems:

    • DNA vaccine approaches expressing YedZ alongside established antigens

    • Live attenuated Yersinia pseudotuberculosis vectors expressing Y. pestis YedZ

    • Nanoparticle-based delivery systems with multiple antigens including YedZ

  • Vectored approaches: Attenuated strains like Y. pseudotuberculosis PB1+ (χ10069) with ΔyopK ΔyopJ Δasd mutations have successfully delivered other Y. pestis antigens and could be adapted for YedZ delivery.

Preliminary studies with other recombinant Y. pestis antigens have shown that strategic antigen combinations delivered through appropriate vectors can induce robust immune responses and protection against lethal Y. pestis challenge .

What methodological approaches are most suitable for studying YedZ interactions with other bacterial proteins?

Studying YedZ interactions with other bacterial proteins requires specialized techniques appropriate for membrane protein complexes:

  • In vivo approaches:

    • Bacterial two-hybrid systems modified for membrane proteins

    • Protein fragment complementation assays

    • FRET/BRET-based interaction assays in bacterial cells

    • In vivo cross-linking followed by mass spectrometry (XL-MS)

  • In vitro methods:

    • Co-purification approaches with mild detergents

    • Surface plasmon resonance with reconstituted proteoliposomes

    • Native mass spectrometry of membrane protein complexes

    • Isothermal titration calorimetry for quantitative binding parameters

  • Structural studies of complexes:

    • Cryo-electron microscopy of membrane protein complexes

    • X-ray crystallography of co-purified complexes

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Computational prediction and validation:

    • Molecular docking simulations

    • Coevolution analysis to predict interaction surfaces

    • Molecular dynamics simulations to assess stability of predicted complexes

These approaches can reveal YedZ's position in bacterial protein interaction networks and potential roles in broader cellular processes .

How do post-translational modifications affect YedZ function in Y. pestis, and how can they be characterized?

Post-translational modifications (PTMs) of YedZ in Y. pestis potentially influence its function through several mechanisms, requiring sophisticated characterization methods:

  • Potential PTMs affecting YedZ:

    • Heme attachment: The primary functional modification for YedZ activity

    • Phosphorylation: Possibly regulating activity or protein interactions

    • Lipid modifications: Potentially affecting membrane localization

    • Oxidative modifications: May impact redox sensing capabilities

  • Analytical approaches for PTM identification:

    • Mass spectrometry-based proteomic analysis:

      • Bottom-up proteomics for site-specific modification mapping

      • Top-down proteomics for intact protein analysis

      • Multiple reaction monitoring for targeted quantification

    • Spectroscopic methods for heme attachment characterization:

      • UV-visible spectroscopy

      • Resonance Raman spectroscopy

      • Electron paramagnetic resonance

  • Functional impact assessment:

    • Site-directed mutagenesis of modified residues

    • Comparative analysis of enzyme kinetics before and after modification

    • Structural studies to determine conformational changes resulting from modifications

  • Temporal regulation of PTMs:

    • Analysis across bacterial growth phases

    • Examination under different environmental conditions (temperature, pH, oxygen)

    • Changes during host-pathogen interactions

These comprehensive approaches can elucidate how PTMs contribute to the regulation and function of YedZ in Y. pestis, potentially revealing new aspects of bacterial adaptation mechanisms .

What are the current limitations in our understanding of YedZ function in Y. pestis?

Despite progress in YedZ research, several significant knowledge gaps remain:

  • Precise physiological function: While YedZ is categorized as a sulfoxide reductase heme-binding subunit, its exact role in Y. pestis metabolism remains incompletely characterized.

  • Substrate specificity: The natural substrates for YedZ-associated enzymatic activities have not been definitively identified in Y. pestis.

  • Regulatory networks: The pathways controlling YedZ expression under different environmental conditions are poorly understood.

  • Protein-protein interactions: The complete interaction network of YedZ with other bacterial proteins remains to be elucidated.

  • Structure-function relationships: Despite structural data for YedZ family proteins, the precise mechanism of electron transfer and the role of specific amino acid residues are not fully characterized.

  • In vivo significance: The importance of YedZ for Y. pestis survival and virulence in relevant infection models has not been comprehensively assessed.

These limitations present significant opportunities for future research to enhance our understanding of this protein in Y. pestis biology .

What emerging technologies might advance our understanding of YedZ in bacterial pathogenesis?

Several cutting-edge technologies show promise for advancing YedZ research:

  • Single-cell technologies:

    • Single-cell RNA-seq to capture expression heterogeneity

    • Time-resolved single-cell proteomics for dynamic protein expression profiling

    • Single-cell metabolomics to link YedZ to metabolic pathways

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize YedZ localization with nanometer precision

    • Correlative light and electron microscopy (CLEM) for structural context

    • In situ cryo-electron tomography for native membrane visualization

  • Genome engineering advances:

    • CRISPR interference for precise temporal control of YedZ expression

    • Base editing for introducing specific mutations without selectable markers

    • Multiplex genome engineering to study YedZ in complex genetic backgrounds

  • Computational approaches:

    • Machine learning for predicting protein interactions and functions

    • Systems biology modeling of YedZ in metabolic networks

    • Molecular dynamics simulations with improved force fields for membrane proteins

  • In vivo monitoring:

    • Biosensors for real-time monitoring of YedZ activity

    • Intravital microscopy to track Y. pestis expressing tagged YedZ during infection

    • Host-pathogen transcriptomics to capture interaction dynamics

These technologies can provide unprecedented insights into YedZ function and its role in Y. pestis pathogenesis .

How can functional genomics approaches be applied to better understand YedZ's role in the broader context of Y. pestis physiology?

Functional genomics offers powerful approaches to contextualize YedZ within Y. pestis biology:

  • Genome-wide interaction screens:

    • Transposon insertion sequencing (Tn-Seq) to identify genetic interactions with YedZ

    • CRISPR interference screens to identify synthetic lethal/sick interactions

    • Suppressor mutation analysis to identify compensatory pathways

  • Transcriptomic approaches:

    • RNA-Seq comparing wild-type and YedZ mutants under various conditions

    • Ribosome profiling to assess translational impacts

    • Dual RNA-Seq during host-pathogen interactions to capture dynamic responses

  • Proteomics strategies:

    • Quantitative proteomics comparing wild-type and YedZ-deficient strains

    • Protein turnover analysis using stable isotope labeling

    • Spatial proteomics to determine subcellular localization changes

  • Metabolomic analysis:

    • Targeted metabolomics focusing on redox-related metabolites

    • Flux analysis using stable isotope tracers

    • Integration with proteomic data for pathway identification

  • Systems biology integration:

    • Multi-omics data integration

    • Network analysis to position YedZ in biological pathways

    • Predictive modeling of bacterial responses to environmental stresses

These approaches would provide a comprehensive understanding of YedZ's functions in Y. pestis and could reveal unexpected roles beyond its predicted involvement in electron transfer processes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.