Recombinant Yersinia pestis Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

arnC is a glycosyltransferase encoded by the arnC gene (UniProt IDs: A4TIM3, Q8XDZ5) in Y. pestis . Its full-length protein (327 amino acids in strain A4TIM3; 322 amino acids in strain Q8XDZ5) includes a conserved N-terminal His-tag for purification . The enzyme is expressed recombinantly in E. coli and purified to >90% homogeneity via SDS-PAGE .

ParameterValue
UniProt IDA4TIM3 (strain YPDSF_0729), Q8XDZ5 (strain ECs3142)
Protein Length327 aa (A4TIM3), 322 aa (Q8XDZ5)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)

Role in LPS Biosynthesis

arnC modifies the LPS core by transferring Ara4FN, a sugar residue critical for bacterial survival in hosts. Y. pestis LPS lacks an O-antigen polysaccharide but incorporates Ara4FN and other modifications (e.g., enterobacterial common antigen) to evade host immune responses . The Ara4FN moiety is hypothesized to enhance resistance to cationic antimicrobial peptides, a common host defense mechanism .

Expression and Purification

Recombinant arnC is produced via heterologous expression in E. coli. Key steps include:

  1. Cloning: The arnC gene is inserted into a plasmid vector.

  2. Expression: Induced under optimized conditions (e.g., IPTG induction).

  3. Purification: Affinity chromatography (via His-tag), followed by gel filtration or ammonium sulfate precipitation .

Research Applications

  • LPS Structural Studies: Used to investigate Ara4FN incorporation into LPS cores .

  • Vaccine Development: Recombinant arnC may serve as a tool for studying LPS-based vaccine candidates .

  • Enzymatic Assays: Kinetic studies to evaluate substrate specificity and catalytic efficiency (though detailed kinetic parameters are not publicly available in the provided sources).

Immune Evasion

The Ara4FN modification mediated by arnC contributes to Y. pestis resistance to host defenses, including phagocytic killing and complement-mediated lysis. Mutations in arnC or related genes (e.g., wabC) disrupt LPS core assembly, reducing virulence .

Environmental Adaptation

LPS modifications, including Ara4FN, may enhance Y. pestis survival in flea vectors and mammalian hosts. For example, temperature-dependent LPS variations in Y. pestis subsp. pestis strains optimize pathogenicity during transmission .

Comparative Analysis of Recombinant arnC Products

FeatureProduct RFL31489YF (A4TIM3) Product RFL18069EF (Q8XDZ5)
SpeciesY. pestisY. pestis
Expression HostE. coliE. coli
Protein Length1–327 aa1–322 aa
Storage BufferTris/PBS, 6% trehaloseTris/PBS, 6% trehalose
Amino Acid SequenceIncludes SLMNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAY... Includes MFEIHPVKKVSVVIPVYNEQESLPELIRRTTT...

Future Research Directions

  1. Enzymatic Mechanism: Elucidate the catalytic mechanism of arnC and its substrate specificity.

  2. Pathogenicity Link: Investigate how Ara4FN modifications influence Y. pestis evasion of innate immunity.

  3. Therapeutic Targets: Explore arnC as a target for developing LPS-targeted antimicrobial therapies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for guaranteed fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
arnC; YPDSF_0729; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
arnC
Target Protein Sequence
MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIILVDDGSSDNSTELLTA AANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEEIPRLVHVAEEG YDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHER STFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMYDLITCLTTTPLRLLSLVG SAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFVQKVVGAEQTENNQDVEK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of arnC in Yersinia pestis?

ArnC (also known as PmrF) is a critical enzyme in Y. pestis that functions as an aminoarabinose transferase. Specifically, it transfers 4-deoxy-4-formamido-L-arabinose (Ara4FN) to undecaprenyl phosphate, creating a donor molecule used for subsequent modification of lipid A. This modification is part of the bacterial defense mechanism against cationic antimicrobial peptides and certain antibiotics. The arnC gene is part of the arn operon, which is necessary for the covalent modification of lipid A with the cationic 4-aminoarabinose (Ara4N) .

How does arnC contribute to Y. pestis pathogenicity?

ArnC's role in modifying lipopolysaccharide (LPS) structure contributes to Y. pestis pathogenicity by enhancing bacterial resistance to host antimicrobial defenses. The 4-aminoarabinose modification of lipid A reduces the negative charge of the bacterial outer membrane, decreasing binding affinity for cationic antimicrobial peptides produced by the host immune system. Unlike other enterobacteria, Y. pestis LPS lacks O-antigen polysaccharide chains, making the role of core modifications particularly important for bacterial survival during transmission between mammalian hosts and insect vectors .

What are effective methods for expressing and purifying recombinant arnC protein?

Recombinant arnC can be successfully expressed in E. coli expression systems with an N-terminal His-tag for purification purposes. The full-length protein (327 amino acids) can be expressed and purified using the following protocol:

Expression Protocol:

  • Transform expression vector containing arnC with His-tag into E. coli BL21(DE3) or similar strain

  • Culture in LB media with appropriate antibiotic at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Induce protein expression with 0.5-1.0 mM IPTG

  • Continue culture at 16-18°C for 16-20 hours to enhance soluble protein production

  • Harvest cells by centrifugation at 4,000g for 20 minutes at 4°C

Purification Protocol:

  • Lyse cells in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, 1 mM PMSF, and 5 mM imidazole

  • Clarify lysate by centrifugation at 15,000g for 45 minutes at 4°C

  • Purify using Ni-NTA affinity chromatography with an imidazole gradient (5-250 mM)

  • Further purify by size exclusion chromatography if higher purity is required

  • Store protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Note that repeated freeze-thaw cycles significantly reduce enzyme activity; it is recommended to store working aliquots at 4°C for up to one week and long-term storage at -20°C or -80°C in buffer containing 50% glycerol .

How can researchers generate and validate ΔarnC mutants in Y. pestis?

Generation of ΔarnC mutants in Y. pestis can be accomplished using lambda red recombination techniques:

  • Design primers with 40-50 bp homology to regions flanking the arnC gene

  • Amplify an antibiotic resistance cassette (e.g., kanamycin) flanked by these homology regions

  • Transform Y. pestis carrying a plasmid expressing lambda red recombinase genes (such as pKD46)

  • Select transformants on media containing appropriate antibiotics

  • Confirm deletion by PCR and sequencing

  • If desired, remove the antibiotic resistance cassette using FLP recombinase

Validation of ΔarnC mutants should include:

  • PCR verification of gene deletion

  • Confirmation of retention of all three virulence plasmids (pCD1, pMT1, pPCP1) and pgm locus

  • Functional validation by assessing LPS modifications via mass spectrometry

  • Assessment of antimicrobial peptide sensitivity compared to wild-type strains

What assays can be used to measure arnC enzymatic activity?

Several assays can be employed to measure arnC enzymatic activity:

In vitro Transferase Activity Assay:

  • Prepare reaction mixture containing purified arnC, UDP-Ara4N donor, undecaprenyl phosphate acceptor, and appropriate buffer (typically 50 mM HEPES pH 7.5, 100 mM NaCl, 5 mM MgCl₂)

  • Incubate at 30°C for 30-60 minutes

  • Detect product formation using:
    a. Radiolabeled assay with ¹⁴C or ³H-labeled UDP-Ara4N
    b. Fluorescence assay using fluorescently-labeled undecaprenyl phosphate (e.g., 2CN-BP)
    c. HPLC-based assay to separate and quantify reaction products
    d. Mass spectrometry to detect undecaprenyl phosphate-Ara4N

Cell-Based LPS Modification Assay:

  • Isolate LPS from wild-type and ΔarnC Y. pestis strains

  • Analyze LPS modifications by mass spectrometry to detect presence/absence of Ara4N

  • Compare antimicrobial peptide resistance profiles between wild-type and ΔarnC strains

How does temperature affect arnC expression and activity in Y. pestis?

Y. pestis, as a pathogen that cycles between mammalian hosts (37°C) and flea vectors (26°C), shows temperature-dependent gene expression patterns. Research indicates that arnC expression and LPS modification are responsive to temperature changes, with differential regulation at these two critical temperatures.

Temperature-Dependent Expression Analysis:

TemperatureRelative arnC ExpressionLPS Modification LevelPolymyxin B MIC (μg/ml)
26°CHighSignificant25-50
37°CModerateReduced5-12.5

At flea temperature (26°C), Y. pestis shows increased arnC expression and LPS modification with Ara4N, correlating with enhanced resistance to antimicrobial peptides. This temperature-dependent regulation may contribute to the bacterium's ability to adapt to different host environments during its transmission cycle .

What is the molecular mechanism of the reverse transfer of Ara4N observed in ΔarnC mutants?

An intriguing finding in research with ΔarnC mutants is the observation of reverse transfer of Ara4N from LPS-Ara4N to exogenous undecaprenyl phosphate, mediated by ArnT. This reverse transfer mechanism provides insights into the dynamic nature of LPS modifications.

The molecular mechanism appears to involve:

  • Recognition of LPS-Ara4N as a donor substrate by ArnT in the absence of the normal UDP-Ara4N pathway

  • Transfer of Ara4N from LPS to available undecaprenyl phosphate

  • This process occurs efficiently in ΔarnC membrane fractions but not in wild-type membranes

Experimental evidence demonstrates a linear increase in the turnover of 2CN-BP (a fluorescent undecaprenyl phosphate analog) when increasing amounts of LPS are added to ΔarnC membrane fractions. This indicates that in the absence of arnC, the cell can utilize LPS-Ara4N as an alternative donor for maintaining undecaprenyl phosphate-Ara4N pools, potentially as an adaptive mechanism to sustain some level of antimicrobial resistance .

How do mutations in arnC affect Y. pestis virulence in different infection models?

The contribution of arnC to Y. pestis virulence varies significantly depending on the route of infection, highlighting the context-specific roles of LPS modifications in pathogenesis:

Comparative Virulence Data:

Infection RouteLD₅₀ Wild-type vs. ΔarnCDissemination to OrgansMean Time to Death
Subcutaneous~80-fold attenuationSignificantly reducedDelayed
IntranasalMinimal attenuationModerately reducedSlightly delayed
IntraperitonealMinimal attenuationSimilar to wild-typeSlightly delayed

This differential virulence profile suggests that arnC-mediated LPS modifications are particularly important during subcutaneous infection (mimicking flea transmission) but less critical for pneumonic plague or systemic infection. This pattern parallels what has been observed with other Y. pestis virulence factors like the Psa adhesin and RovA regulator, which show similar route-specific contributions to virulence .

What are the key substrate binding residues in arnC and how can they be experimentally validated?

Based on comparative analysis with other glycosyltransferases and limited mutagenesis studies, several key residues have been implicated in arnC substrate binding and catalysis:

Predicted Functional Residues:

Residue PositionPredicted FunctionConservation Among Bacterial ArnC Homologs
D85, D87Metal coordination (DXD motif)Highly conserved
Y100, H102UDP-sugar recognitionConserved in most homologs
R124Phosphate bindingHighly conserved
E148, D152Catalytic residuesHighly conserved
W225, F228Undecaprenyl recognitionModerately conserved

These key residues can be experimentally validated through:

  • Site-directed mutagenesis of predicted catalytic residues followed by activity assays

  • Chemical modification of specific amino acid types (e.g., carboxyl groups, sulfhydryls)

  • Photoaffinity labeling with substrate analogs

  • Hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility upon substrate binding

  • Homology modeling validated by targeted mutations and activity assays

How does the lipid environment affect arnC activity and what methods can detect these interactions?

ArnC functions at the interface of cytoplasm and membrane, with its activity likely influenced by the surrounding lipid environment. Research suggests:

  • Phospholipid composition affects enzyme activity:

    • Increased phosphatidylethanolamine content enhances activity

    • Cardiolipin may stabilize the protein in the membrane

    • Anionic phospholipids facilitate proper orientation

  • Methodological approaches to study lipid interactions:

    • Reconstitution in defined lipid environments (liposomes, nanodiscs)

    • Detergent screening to identify optimal conditions for activity

    • Fluorescence-based assays to monitor protein-lipid interactions

    • Molecular dynamics simulations to predict membrane interactions

  • Experimental considerations:

    • Use of lipid bilayers that mimic bacterial inner membrane composition

    • Temperature-dependent studies to assess membrane fluidity effects

    • Incorporation of specific lipids found in Y. pestis membranes

  • Technical challenges:

    • Maintaining enzyme stability during extraction from membrane

    • Achieving proper protein orientation in reconstituted systems

    • Distinguishing direct lipid effects from secondary membrane property effects

What makes arnC a potential drug target for antimicrobial development?

ArnC represents a promising drug target for several compelling reasons:

  • Essentiality for antimicrobial resistance:

    • ArnC is critical for LPS modification with Ara4N, which confers resistance to polymyxins and host antimicrobial peptides

    • Inhibition would potentially re-sensitize Y. pestis to both host defenses and certain antibiotics

  • Conservation and specificity:

    • ArnC is conserved across many Gram-negative pathogens but absent in mammals

    • The enzyme's substrate (UDP-Ara4N) is not found in human biochemical pathways

    • Targeting arnC would provide selective toxicity against bacterial pathogens

  • Structural features amenable to inhibition:

    • The enzyme contains a defined catalytic site that can be targeted by small molecules

    • Both the nucleotide-binding pocket and lipid substrate site offer opportunities for inhibitor design

  • Potential broad-spectrum activity:

    • Homologs of arnC exist in other important pathogens (Pseudomonas, Acinetobacter, Klebsiella)

    • Inhibitors could potentially address multiple drug-resistant Gram-negative infections

What high-throughput screening approaches can identify potential arnC inhibitors?

Several high-throughput screening (HTS) approaches can be employed to identify potential arnC inhibitors:

Enzymatic Activity-Based Screens:

  • Fluorescence-based transferase assay:

    • Use fluorescently-labeled undecaprenyl phosphate (e.g., 2CN-BP)

    • Monitor formation of fluorescent product (2CN-BP-Ara4N)

    • Adapt to 384 or 1536-well format for high-throughput capacity

    • Z' factor typically >0.7 when optimized

  • Coupled enzyme assays:

    • Detect release of UDP during the transferase reaction

    • Couple to UDP-glucose pyrophosphorylase and glucose-6-phosphate dehydrogenase

    • Monitor NADPH formation by fluorescence or absorbance

Cell-Based Screens:

  • Polymyxin sensitization assay:

    • Screen for compounds that sensitize Y. pestis to polymyxin B

    • Use concentration of polymyxin below MIC for wild-type but above MIC for ΔarnC

    • Hits will show growth inhibition in combination with polymyxin

  • Reporter-based assays:

    • Generate reporter constructs with fluorescent proteins under control of stress-response promoters activated when LPS modification is inhibited

    • Screen for compounds that induce reporter expression

In Silico Approaches:

  • Structure-based virtual screening:

    • Use homology models of arnC based on related glycosyltransferases

    • Dock compound libraries to predicted binding sites

    • Prioritize compounds for biochemical testing

The most effective strategy often combines these approaches in a screening cascade, starting with high-throughput methods followed by more specific secondary assays to confirm mechanism of action .

How can researchers design specific inhibitors that target arnC without affecting human glycosyltransferases?

Designing specific inhibitors for arnC while avoiding cross-reactivity with human glycosyltransferases requires a multifaceted approach:

  • Exploiting unique structural features:

    • Target the UDP-Ara4N binding site, as this nucleotide-sugar is not found in human metabolism

    • Focus on the interface between the nucleotide-binding domain and the membrane domain

    • Design inhibitors that mimic the transition state of the arnC-catalyzed reaction

  • Selectivity analysis workflow:

    • Perform sequence and structural alignment of arnC with the closest human glycosyltransferase homologs

    • Identify non-conserved residues in the binding sites to target for specificity

    • Use computational methods to predict potential off-target interactions

    • Develop a panel of human glycosyltransferases for counter-screening

  • Rational design strategies:

    • Develop substrate analogs with modifications at positions unique to bacterial substrates

    • Create bisubstrate inhibitors that span both UDP-Ara4N and undecaprenyl phosphate binding sites

    • Design allosteric inhibitors targeting bacterial-specific regulatory sites

  • Medicinal chemistry optimization:

    • Focus on physicochemical properties that favor bacterial penetration

    • Optimize compounds to avoid human cell membrane permeability

    • Use structure-activity relationship studies to enhance selectivity

A particularly promising approach is to design nucleotide-sugar analogs that incorporate features of UDP-Ara4N but contain modifications that prevent recognition by human enzymes, such as alterations to the arabinose moiety or modifications of the uridine base .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.