Recombinant Yersinia pestis Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant uspB is typically expressed in E. coli due to high yields and shorter production timelines compared to eukaryotic systems . Key production parameters include:

ParameterDetailsSource
Host OrganismE. coli (commonly BL21 strains)
Yield~1 mg/L culture (varies by strain and optimization)
Purification Steps- Metal affinity chromatography (His-tag binding)
- Anion-exchange chromatography (optional)
Post-PurificationLyophilized powder reconstituted in sterile water or Tris buffer

Alternative hosts like yeast or insect cells are rarely used for uspB due to lower efficiency .

Stress Response Regulation

uspB is part of the bacterial universal stress protein (USP) family, which modulates survival under extreme conditions:

  • Heat/Cold Shock: USPs stabilize cellular structures during temperature shifts .

  • Oxidative Stress: Interacts with detoxification pathways (e.g., reactive oxygen species scavenging) .

  • Acid Resistance: Synergizes with acid shock proteins (e.g., HdeB, AdiA) to maintain membrane integrity .

Comparative Analysis with Other USP Homologs

SpeciesUniProt IDLengthKey Functional DifferenceSource
Y. pestis bv. AntiquaQ1C1B3111 aaN-terminal His-tag for purification
Y. pseudotuberculosisQ664F8111 aaSimilar secondary structure to Y. pestis
Vibrio vulnificusQ8DD90107 aaShorter N-terminal region, altered binding motifs

Implications for Virulence

In Y. pestis, stress proteins like uspB may indirectly influence pathogenicity by enabling survival in host environments. For example, mutants lacking acetylation regulators (e.g., CobB, YfiQ) show reduced biofilm formation and virulence, potentially linked to altered USP activity .

Applications in Research and Industry

Recombinant uspB serves as a tool for:

  1. Stress Response Studies: Probing mechanisms of bacterial adaptation to environmental stressors.

  2. Vaccine Development: While not directly tested, USPs are explored as vaccine targets in other pathogens (e.g., Mycobacterium tuberculosis) .

  3. Diagnostic Assays: ELISA kits for detecting anti-uspB antibodies in infected hosts .

Challenges and Future Directions

  • Limited Functional Data: Most studies focus on production rather than biological roles.

  • Host-Specific Variation: Structural differences between Y. pestis uspB and homologs (e.g., Vibrio) necessitate species-specific research.

  • Therapeutic Potential: Investigating uspB as a target for small-molecule inhibitors to disrupt stress responses in pathogens.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
uspB; YPDSF_3334; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of stress response proteins in Y. pestis virulence?

Stress response proteins play critical roles in Y. pestis adaptation to various environmental conditions and host defense mechanisms. Recent research demonstrates that protein modification systems, particularly acetylation mediated by YfiQ and CobB, significantly influence Y. pestis tolerance to environmental stressors including cold, heat, high-salt, and acidic conditions . These protein modifications regulate the expression of genes encoding heat shock proteins (HtpG, HslV, HslR, and IbpA), cold shock proteins (CspC and CspA1), and acid resistance proteins (HdeB and AdiA) . Stress response systems are therefore integral to Y. pestis survival during transmission between hosts and vectors, as well as during initial infection stages.

How does Y. pestis adapt to different host environments?

Y. pestis demonstrates remarkable adaptability across diverse host environments. The bacterium utilizes sophisticated mechanisms to navigate the transition between vectors and mammalian hosts. For example, Y. pestis exploits interaction with SIGNR1 (CD209b), a C-type lectin receptor found on antigen-presenting cells, via its core lipopolysaccharide (LPS) structure . This interaction enhances bacterial dissemination through host tissues, particularly during bubonic plague transmission . Additionally, Y. pestis demonstrates adaptive evolution through modifications in regulatory systems like the stringent response pathway involving pppGpp to ppGpp conversion, which influences survival within human macrophages .

What experimental models are most appropriate for studying Y. pestis stress proteins?

When investigating Y. pestis stress proteins, researchers typically employ several complementary models:

  • In vitro bacterial culture systems: These allow for controlled manipulation of environmental conditions (temperature, pH, nutrient availability) to assess stress protein expression and function.

  • Macrophage infection models: Peritoneal macrophages from wild-type and receptor knockout mice (such as SIGNR1 KO) provide valuable insights into host-pathogen interactions and bacterial stress responses .

  • Mouse infection models: Swiss Webster mice and C57BL/6J mice are commonly used to evaluate the role of stress proteins in virulence through subcutaneous (mimicking bubonic plague) or intravenous (mimicking septicemic plague) inoculation routes .

  • Recombinant attenuated Yersinia strains: Modified strains such as Y. pseudotuberculosis PB1+ with specific mutations (Δ yopK Δ yopJ Δ asd) can serve as platforms for studying stress protein expression and vaccine development .

What are effective strategies for cloning and expressing recombinant Y. pestis uspB?

For effective cloning and expression of Y. pestis uspB, researchers should consider:

  • Vector selection: A balanced approach using vectors with moderate promoter strength can prevent potential toxicity issues while ensuring adequate protein expression. Plasmid systems like pYA3332 and pYA5199, which have been successfully used for other Y. pestis proteins, can be adapted for uspB expression .

  • Expression host: While E. coli is commonly used for initial expression studies, using attenuated Y. pseudotuberculosis strains (such as χ10069) as expression hosts may provide a more physiologically relevant environment for proper folding and modification of uspB .

  • Induction conditions: Optimizing temperature, inducer concentration, and induction time is crucial for maximal soluble protein yield. For stress proteins, lower induction temperatures (16-25°C) often improve solubility.

  • Codon optimization: Consider codon optimization based on the expression host to enhance translation efficiency, particularly for rare codons that might be present in the uspB sequence.

What purification methods yield highest purity and activity for recombinant uspB?

Purification of recombinant uspB should employ a multi-step approach:

  • Initial capture: Affinity chromatography using His-tag or other fusion tags provides an effective initial purification step.

  • Intermediate purification: Ion exchange chromatography can separate uspB from similarly charged contaminants.

  • Polishing: Size exclusion chromatography helps remove aggregates and ensures homogeneity of the final product.

  • Activity preservation: Throughout purification, maintain conditions that preserve protein structure and function, including appropriate buffer composition, pH (typically 7.2-7.6 for Y. pestis proteins), and addition of stabilizers if necessary.

  • Endotoxin removal: For functional studies, endotoxin removal is essential to prevent confounding effects in downstream analyses.

How can researchers verify proper folding and activity of recombinant uspB?

Verification of proper folding and activity should include:

  • Structural analysis: Circular dichroism spectroscopy and thermal shift assays to assess secondary structure and stability.

  • Functional assays: Based on the hypothesized function of uspB, develop specific activity assays such as ATP binding/hydrolysis measurements or protein-protein interaction studies.

  • Stress response assays: Similar to studies with other Y. pestis stress proteins, examine the ability of recombinant uspB to complement stress sensitivity in knockout strains under various conditions (cold, heat, oxidative stress) .

  • Protein-protein interaction studies: Pull-down assays or yeast two-hybrid systems to identify potential interaction partners within the stress response network, similar to methodologies used to study YfiQ and CobB interactions .

How does uspB expression change under different environmental stressors?

While specific data on uspB expression patterns is not directly available in the search results, research approaches similar to those used for other Y. pestis stress response proteins could be applied:

  • Transcriptomic analysis: RNA-seq under various stress conditions (temperature shifts, pH changes, nutrient limitation, oxidative stress) can reveal transcriptional regulation patterns of uspB, similar to comparative transcriptomic approaches used to study other Y. pestis stress response genes .

  • Quantitative PCR: Real-time qPCR to precisely measure uspB expression levels under controlled stress conditions.

  • Reporter gene fusions: Construction of uspB promoter-reporter gene fusions to monitor expression in real-time during exposure to different stressors.

  • Proteomics: Mass spectrometry-based proteomic analysis to quantify uspB protein levels and potential post-translational modifications in response to stress conditions.

What is the relationship between uspB and other stress response pathways in Y. pestis?

Understanding the relationship between uspB and other stress response pathways requires integrative approaches:

  • Protein interaction networks: Techniques such as bacterial two-hybrid systems, co-immunoprecipitation, or proximity labeling can identify proteins that interact with uspB during stress responses.

  • Genetic interaction studies: Construction of single and double knockout mutants combining uspB deletion with other stress response genes to identify genetic interactions and pathway relationships.

  • Signaling pathway analysis: Investigation of potential connections between uspB and known stress signaling pathways, such as the stringent response system involving pppGpp/ppGpp, which has been implicated in Y. pestis virulence and macrophage survival .

  • Comparative genomics: Analysis of uspB conservation and genetic context across Yersinia species and strains with different virulence profiles, similar to evolutionary analyses performed for other Y. pestis genes .

How might uspB contribute to Y. pestis survival within macrophages?

The contribution of uspB to intracellular survival could be investigated through:

  • Macrophage infection assays: Compare survival of wild-type and uspB-deficient Y. pestis strains in macrophage infection models, similar to studies performed with SIGNR1 knockout models .

  • Microscopy: Fluorescence microscopy to track intracellular localization of uspB during macrophage infection.

  • Transcriptional profiling: RNA-seq analysis of uspB-deficient vs. wild-type Y. pestis during macrophage infection to identify altered gene expression patterns.

  • Stress mimicry: In vitro experiments simulating conditions encountered within macrophages (low pH, oxidative stress, nutrient limitation) to assess uspB contribution to survival under these specific stressors.

How can uspB be utilized in vaccine development strategies?

The potential application of uspB in vaccine development could follow similar approaches to those used with other Y. pestis proteins:

  • Antigen delivery systems: Evaluation of uspB as a potential protective antigen when delivered by attenuated Y. pseudotuberculosis strains, similar to the YopE-LcrV fusion protein approach .

  • Adjuvant properties: Assessment of whether uspB possesses adjuvant properties that could enhance immune responses to co-delivered antigens.

  • Epitope mapping: Identification of immunogenic epitopes within uspB that could be incorporated into multi-epitope vaccine candidates.

  • Immunization protocols: Optimization of dose, route, and schedule for uspB-based immunization, with evaluation of both mucosal and systemic immune responses .

  • Protection assessment: Challenge studies to determine protective efficacy against different Y. pestis strains and infection routes.

What are the key considerations for uspB knockout or modification studies?

When designing genetic manipulation studies targeting uspB:

  • Clean deletion strategies: Use markerless deletion techniques to avoid polar effects on adjacent genes.

  • Complementation controls: Include complementation with wild-type uspB to confirm phenotypic changes are specifically due to uspB deletion.

  • Site-directed mutagenesis: Target specific functional domains or residues within uspB to dissect structure-function relationships.

  • Conditional expression systems: Consider using inducible promoters to control uspB expression, particularly if complete deletion proves lethal or severely attenuating.

  • In vivo verification: Confirm in vitro phenotypes through appropriate animal models, assessing colonization, dissemination, and virulence parameters .

How might uspB function differ between ancient and modern Y. pestis strains?

Understanding evolutionary aspects of uspB function requires:

  • Comparative genomics: Analysis of uspB sequence conservation across ancient and modern Y. pestis lineages, similar to analyses performed for other virulence factors .

  • Ancestral sequence reconstruction: Computational prediction and experimental testing of ancestral uspB variants.

  • Functional complementation: Cross-complementation studies using uspB from ancient and modern strains to identify functional differences.

  • Ecological context: Consideration of different ecological niches occupied by ancient and modern Y. pestis strains, as identified in phylogenomic studies, and how these might influence uspB function .

  • Host adaptation signatures: Analysis of selection pressures on uspB sequence during adaptation to different hosts throughout Y. pestis evolutionary history.

What are common pitfalls in uspB functional studies and how can they be addressed?

Researchers should be aware of several methodological challenges:

  • Functional redundancy: Universal stress proteins often belong to multigene families with potentially overlapping functions. Construction of multiple gene knockouts may be necessary to observe clear phenotypes.

  • Condition-specific activity: uspB function may only be apparent under specific stress conditions. Systematic testing across diverse stressors is recommended.

  • Post-translational modifications: Consider that uspB function may be regulated by modifications such as acetylation, as observed with other Y. pestis stress response proteins . Techniques like mass spectrometry should be employed to identify such modifications.

  • Physiological relevance: Validate findings from in vitro studies in more complex models that better recapitulate in vivo conditions.

  • Strain background effects: Phenotypes may vary between different Y. pestis strains. Include multiple reference strains in key experiments.

How can researchers distinguish between direct and indirect effects of uspB manipulation?

Distinguishing direct and indirect effects requires:

  • Temporal analysis: Monitoring immediate versus delayed responses following uspB perturbation.

  • Biochemical confirmation: In vitro reconstitution of proposed biochemical activities using purified components.

  • Proximity labeling: Use of techniques like BioID to identify proteins in close proximity to uspB in vivo.

  • Epistasis analysis: Genetic approaches to determine pathway relationships and hierarchy.

  • Systems biology approaches: Integration of transcriptomic, proteomic, and metabolomic data to build comprehensive models of uspB function within stress response networks.

What statistical approaches are recommended for analyzing uspB-related experimental data?

Robust statistical analysis for uspB studies should include:

  • Appropriate replication: Minimum of three biological replicates for each experimental condition.

  • Power analysis: Pre-experiment calculation of required sample sizes based on expected effect sizes.

  • Normalization strategies: Proper normalization for qPCR, RNA-seq, and proteomics data to account for technical variables.

  • Multiple testing correction: Application of false discovery rate control when performing multiple comparisons.

  • Advanced modeling: Consider mixed-effects models when analyzing data with multiple sources of variation.

  • Reproducibility measures: Report effect sizes and confidence intervals in addition to p-values.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.