Recombinant Yersinia pestis UPF0059 membrane protein YPDSF_1370 (YPDSF_1370)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Yersinia pestis UPF0059 Membrane Protein YPDSF_1370

Recombinant Yersinia pestis UPF0059 membrane protein YPDSF_1370, also referred to as YPDSF_1370, is a protein derived from the bacterium Yersinia pestis, the causative agent of plague. This protein is classified under the UPF0059 family of membrane proteins, which are characterized by their roles in various cellular processes, including virulence and immune evasion. The recombinant form of this protein is produced in Escherichia coli and is often tagged with a histidine (His) tag for purification purposes.

Characteristics of YPDSF_1370

Protein Structure

The primary structure of YPDSF_1370 consists of a sequence of amino acids that dictate its three-dimensional conformation and function. The full-length protein consists of 256 amino acids, with the following notable features:

  • UniProt ID: Q1CJ34

  • Gene Name: YPDSF_1370

  • Source: Escherichia coli

  • Purity: Greater than 90% as determined by SDS-PAGE.

The amino acid sequence is crucial for understanding the protein's interactions and functions within the bacterial membrane.

Functional Role

YPDSF_1370 is believed to play a role in the pathogenicity of Yersinia pestis. Membrane proteins like YPDSF_1370 can be involved in processes such as:

  • Cell adhesion

  • Immune system evasion

  • Nutrient transport

Research Findings

Recent studies have focused on understanding the structure-function relationship of YPDSF_1370 and its potential as a vaccine candidate.

Protective Potential

Research has shown that outer membrane proteins, including those from Yersinia pestis, can elicit protective immune responses. For instance, antibodies generated against YPDSF_1370 may provide protection against various strains of Yersinia pestis.

Immunogenicity Studies

In immunogenicity studies, recombinant proteins derived from Yersinia pestis, including YPDSF_1370, were tested for their ability to provoke an immune response in animal models. These studies indicated that:

  • Antibodies against YPDSF_1370 could neutralize the bacterium's virulence factors.

  • The protein could be a candidate for inclusion in multivalent vaccines aimed at providing broader protection against plague.

Data Table: Characteristics of Recombinant YPDSF_1370

FeatureDetails
Protein NameRecombinant Yersinia pestis UPF0059
Gene NameYPDSF_1370
UniProt IDQ1CJ34
Length (aa)256
Expression SystemEscherichia coli
Tag TypeHis-tag
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; YPDSF_1370; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
mntP
Target Protein Sequence
MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA
Uniprot No.

Target Background

Function
This protein is likely to function as a manganese efflux pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0059 membrane protein YPDSF_1370 and what organism does it originate from?

The UPF0059 membrane protein YPDSF_1370 is a membrane-associated protein found in Yersinia pestis, the causative agent of plague. This protein belongs to the UPF0059 family of uncharacterized proteins. While its precise function remains under investigation, it is classified as a membrane protein, suggesting potential roles in membrane integrity, transport, signaling, or host-pathogen interactions. Yersinia pestis is a gram-negative bacterium and one of the most significant human pathogens in history, responsible for several plague pandemics .

The protein is 189 amino acids in length and has been assigned the UniProt accession number A4TKE7. Structural analysis suggests it contains transmembrane domains characteristic of integral membrane proteins, though detailed structural studies are still limited .

What expression systems are recommended for producing recombinant YPDSF_1370 protein?

Recombinant UPF0059 membrane protein YPDSF_1370 can be successfully expressed in multiple host systems, each offering distinct advantages:

  • E. coli expression system:

    • Provides optimal yields for YPDSF_1370

    • Offers shorter turnaround times

    • Typically used with N-terminal His-tag for purification

    • Most suitable for structural studies requiring high protein quantities

  • Yeast expression system:

    • Balances good yields with some eukaryotic post-translational modifications

    • Provides proper folding for membrane proteins

    • Intermediate complexity between prokaryotic and mammalian systems

  • Insect cell/baculovirus expression:

    • Provides many post-translational modifications

    • Better suited when protein folding is challenging in simpler systems

    • Maintains activity for functional studies

  • Mammalian cell expression:

    • Offers the most complete post-translational modifications

    • Best for maintaining native protein conformation and function

    • Recommended when activity assays are the primary objective

    • Typically lower yields but higher biological relevance

The choice of expression system should be determined by the specific research objectives. For structural studies requiring large quantities, E. coli expression with His-tagging (as described in source material) is most efficient. For functional studies, insect or mammalian systems may be more appropriate despite lower yields .

What purification methods yield the highest purity for recombinant YPDSF_1370?

To achieve high purity (>90%) of recombinant YPDSF_1370, as required for most research applications, a multi-step purification protocol is recommended:

  • Primary affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 0.1% appropriate detergent

    • Elution with imidazole gradient (50-250 mM)

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and impurities

    • Buffer: 20 mM Tris-HCl pH 7.5, 150 mM NaCl, detergent below CMC

  • Quality assessment:

    • SDS-PAGE with Coomassie staining (should show >90% purity)

    • Western blot using anti-His antibodies

    • Mass spectrometry for identity confirmation

Current protocols typically achieve greater than 90% purity as determined by SDS-PAGE analysis, which is suitable for most research applications including structural studies and protein-protein interaction analyses .

What detergents are most effective for solubilizing YPDSF_1370 during purification?

As a membrane protein, YPDSF_1370 requires careful detergent selection for efficient extraction from membranes while maintaining native structure. Based on similar membrane proteins from Yersinia pestis, the following detergents have demonstrated effectiveness:

DetergentClassificationCMC (mM)Recommended ConcentrationAdvantagesLimitations
n-Dodecyl β-D-maltoside (DDM)Non-ionic0.171% for extraction, 0.05% for purificationMild, preserves functionLarger micelles
n-Octyl β-D-glucopyranoside (OG)Non-ionic23-242% for extraction, 0.7% for purificationEasily dialyzableCan be destabilizing
DigitoninNon-ionic steroid0.51% for extraction, 0.1% for purificationVery mild, good for complexesExpensive, variable purity
LMNG (Lauryl maltose neopentyl glycol)Non-ionic0.010.1% for extraction, 0.01% for purificationHighly stabilizingDifficult to remove

Selection should be guided by downstream applications. For structural studies requiring stable protein, DDM or LMNG are recommended. For functional assays where detergent removal may be necessary, OG might be preferable despite potential destabilization risks.

How does the structure of YPDSF_1370 compare to other UPF0059 family proteins, and what functional insights can be derived?

Comparative structural analysis of YPDSF_1370 with other UPF0059 family proteins reveals important insights despite the limited characterization of this protein family:

  • Structural features:

    • Contains predicted α-helical transmembrane domains

    • Likely forms a bundle of 4-6 transmembrane helices

    • Shows conserved charged residues at predicted membrane interfaces

    • Contains a characteristic cytoplasmic domain with potential regulatory function

  • Phylogenetic comparison:

    • Highest homology with UPF0059 proteins from other pathogenic Yersinia species

    • Moderate conservation with enterobacteriaceae family members

    • Key residues in transmembrane regions show higher conservation than cytoplasmic domains

  • Functional implications:

    • Conserved membrane topology suggests potential roles in:

      • Ion or small molecule transport

      • Membrane integrity maintenance

      • Signal transduction across the membrane

      • Potential virulence factor based on conservation in pathogenic species

While definitive functional annotation awaits experimental validation, structural homology modeling based on related proteins suggests involvement in bacterial membrane homeostasis potentially linked to pathogenicity. The high degree of conservation in certain membrane-spanning regions indicates functional importance that could be exploited for therapeutic targeting.

What are the optimal conditions for functional assays of YPDSF_1370, and how can activity be quantitatively measured?

Designing functional assays for poorly characterized membrane proteins like YPDSF_1370 requires a multi-faceted approach guided by structural predictions and comparative analysis:

  • Membrane integrity assays:

    • Liposome leakage assays using purified YPDSF_1370 reconstituted in proteoliposomes

    • Measurement parameters: fluorescent dye release rates at varying protein concentrations

    • Controls: empty liposomes and liposomes with known channel proteins

    • Quantification: EC50 values for concentration-dependent effects

  • Ion flux measurements:

    • Patch-clamp studies of cells overexpressing YPDSF_1370

    • Conditions: multiple buffer compositions to identify potential ion selectivity

    • Measurement: current changes under various membrane potentials

    • Analysis: conductance calculations and ion selectivity profiling

  • Protein-protein interaction assays:

    • Pull-down experiments with bacterial lysates to identify binding partners

    • Biolayer interferometry with purified candidate interactors

    • Crosslinking mass spectrometry to map interaction interfaces

    • FRET-based assays for real-time interaction monitoring

  • Environmental response testing:

    • Activity measurements under varying pH (5.0-8.0), temperature (25-42°C), and ionic conditions

    • Stress response analysis (oxidative, osmotic, antibiotic challenge)

    • In vivo mutant complementation assays in Yersinia

For all functional assays, recombinant YPDSF_1370 expressed in mammalian or insect cells is preferable to E. coli-expressed protein despite lower yields, as the proper folding and post-translational modifications are critical for activity assessment .

How does YPDSF_1370 contribute to Yersinia pestis pathogenesis, and what experimental approaches can elucidate its role?

While YPDSF_1370's specific contribution to Yersinia pestis pathogenesis remains incompletely characterized, several experimental approaches can be employed to investigate its potential role:

  • Gene knockout and complementation studies:

    • CRISPR-Cas9 mediated deletion of YPDSF_1370 in Yersinia pestis

    • Phenotypic analysis of mutant strains for:

      • Growth kinetics in various media

      • Resistance to environmental stressors

      • Biofilm formation capacity

      • Host cell adhesion and invasion efficiency

    • Complementation with wild-type and site-directed mutants

  • Infection models:

    • Macrophage infection assays comparing wild-type and YPDSF_1370-deficient strains

    • Measurement of bacterial survival, replication, and host cell responses

    • Animal infection models (typically mouse) to assess virulence attenuation

    • Tissue distribution and bacterial load quantification

  • Immunological studies:

    • Analysis of host immune response to purified YPDSF_1370

    • Cytokine profiling after exposure to wild-type vs. mutant bacteria

    • Potential immunomodulatory effects on host innate immunity

  • Integration with known virulence mechanisms:

    • Potential interactions with established virulence factors like F1 antigen

    • Investigation of co-regulation with known virulence genes

    • Transcriptomic analysis during infection progression

While the F1 antigen has been established as a major virulence factor of Yersinia pestis , the role of membrane proteins like YPDSF_1370 may involve more subtle aspects of the bacterium's interaction with host environments or stress adaptation during infection.

What are the challenges in crystallizing YPDSF_1370 for structural studies, and what alternative structural determination methods can be applied?

Membrane proteins like YPDSF_1370 present significant challenges for structural determination, with several specific obstacles and alternative approaches:

  • Crystallization challenges:

    • Detergent micelles complicate crystal contacts

    • Conformational heterogeneity reduces crystal order

    • Low expression yields limit screening capacity

    • Potential instability outside native membrane environment

  • Optimization strategies for X-ray crystallography:

    • Lipidic cubic phase crystallization

    • Antibody fragment co-crystallization to increase polar surface area

    • Systematic detergent screening (vapor diffusion with 96 detergent conditions)

    • Thermostability assays to identify stabilizing conditions

  • Alternative structural determination methods:

    MethodResolution RangeSample RequirementsAdvantagesLimitations
    Cryo-electron microscopy2.5-4Å for membrane proteins of this size0.1-0.5 mg purified proteinNative-like lipid environment possibleChallenging for proteins <100 kDa
    NMR spectroscopyAtomic resolution for portions5-15 mg isotope-labeled proteinDynamic information obtainableSize limitations, complex spectra
    Small-angle X-ray scattering10-20Å1-2 mg purified proteinLow-resolution envelope, flexible regionsLimited resolution
    Hydrogen-deuterium exchange MSPeptide-level resolution0.1 mg unlabeled proteinIdentifies exposed/protected regionsNot a true structural technique
    AlphaFold2 predictionAtomic model with confidence metricsSequence onlyNo experimental sample neededValidation still required
  • Integrative structural biology approach:

    • Combining computational predictions (AlphaFold2) with experimental constraints

    • Limited proteolysis to identify domain boundaries

    • Cross-linking mass spectrometry for distance constraints

    • Evolutionary covariance analysis for contact prediction

For YPDSF_1370, an E. coli expression system with His-tagging provides sufficient yields for structural biology approaches , but careful detergent selection and stability optimization would be critical for successful structural determination.

How can protein-protein interaction networks involving YPDSF_1370 be mapped to understand its biological context?

Mapping the protein-protein interaction (PPI) network of YPDSF_1370 requires a multi-method approach that accounts for its membrane localization:

  • Proximity-dependent labeling approaches:

    • BioID or TurboID fusion proteins expressed in Yersinia

    • APEX2 peroxidase fusions for rapid biotinylation

    • Quantitative proteomics to identify enriched proteins

    • Controls: cytoplasmic marker proteins, non-specific membrane proteins

  • Co-immunoprecipitation strategies:

    • Detergent optimization for membrane protein extraction

    • Crosslinking prior to solubilization to capture transient interactions

    • Quantitative comparison to control immunoprecipitations

    • Validation by reciprocal pull-downs

  • Yeast two-hybrid adaptations:

    • Split-ubiquitin membrane yeast two-hybrid system

    • MYTH (membrane yeast two-hybrid) screening against Yersinia cDNA library

    • Systematic testing against candidate partners

  • In silico network analysis:

    • Integration with existing bacterial interactome data

    • Prediction of functional associations via STRING database

    • Co-expression analysis across infection conditions

  • Validation and characterization:

    • Surface plasmon resonance for binding kinetics

    • Microscale thermophoresis for affinity determination

    • FRET/FLIM for spatial validation in live bacteria

    • Functional assays to determine biological relevance of interactions

The recombinant expression of YPDSF_1370 with appropriate tags facilitates these interaction studies, though expression systems that maintain proper folding and post-translational modifications (insect or mammalian cells) may provide more biologically relevant interaction partners than E. coli-expressed protein .

What quality control measures should be implemented when working with recombinant YPDSF_1370 protein?

  • Protein identity verification:

    • Mass spectrometry confirmation (LC-MS/MS)

    • N-terminal sequencing of at least first 10 amino acids

    • Western blot with anti-His antibodies or protein-specific antibodies if available

  • Purity assessment:

    • SDS-PAGE with densitometry analysis (target >90% purity)

    • Size exclusion chromatography profiles

    • Reverse-phase HPLC analysis

  • Structural integrity evaluation:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Thermal shift assays to determine stability

    • Dynamic light scattering for homogeneity assessment

    • Limited proteolysis to verify proper folding

  • Functional validation:

    • Batch-to-batch comparison using established activity assays

    • Storage stability testing under various conditions

    • Freeze-thaw tolerance assessment

  • Contaminant testing:

    • Endotoxin testing (particularly for E. coli-expressed protein)

    • Host cell protein ELISA for residual contaminants

    • Nucleic acid contamination (A260/A280 ratio)

  • Documentation standards:

    • Complete expression and purification records

    • Lot-specific analytical certificates

    • Standardized storage and handling protocols

Quality control data should be systematically recorded and included in research documentation to ensure reproducibility. For YPDSF_1370, particular attention should be paid to verifying membrane protein refolding after purification, as improper folding can significantly impact experimental outcomes despite high purity levels.

How should researchers design experiments to compare wild-type versus mutant YPDSF_1370 proteins?

Designing rigorous comparative studies between wild-type and mutant YPDSF_1370 requires careful consideration of multiple experimental factors:

  • Rational mutant design:

    • Selection based on sequence conservation analysis

    • Targeting predicted functional domains or motifs

    • Conservative vs. non-conservative substitutions

    • Systematic alanine-scanning for comprehensive functional mapping

  • Expression and purification controls:

    • Identical expression systems for all variants

    • Parallel purification using identical protocols

    • Quantitative yield comparison to identify destabilizing mutations

    • Equal buffer conditions and protein concentrations

  • Structural integrity verification:

    • Circular dichroism comparison of secondary structure

    • Thermal stability comparison via differential scanning fluorimetry

    • Limited proteolysis patterns to detect conformational changes

  • Experimental design principles:

    • Blind sample coding during experiments

    • Inclusion of biological and technical replicates (minimum n=3)

    • Power analysis for sample size determination

    • Randomization of experiment order

    • Inclusion of positive and negative controls

  • Data analysis framework:

    • Pre-determined statistical analysis methods

    • Multiple testing correction for large-scale comparisons

    • Effect size calculation beyond p-value reporting

    • Transparent reporting of all results including negative findings

This systematic approach ensures that observed differences between wild-type and mutant YPDSF_1370 are genuinely attributable to the specific mutations rather than experimental variables or preparation differences.

What are the best approaches for developing specific antibodies against YPDSF_1370 for research applications?

Developing specific antibodies against membrane proteins like YPDSF_1370 presents unique challenges that require specialized approaches:

  • Antigen preparation strategies:

    • Full-length protein in detergent micelles or nanodiscs

    • Recombinant soluble domains (if identifiable)

    • Synthetic peptides from predicted exposed regions

    • Multiple antigen approach for comprehensive epitope coverage

  • Immunization protocol recommendations:

    Animal ModelAdvantagesDoseScheduleAdjuvant
    RabbitLarger serum volume200-500 μg initial0, 21, 42 daysFreund's/TiterMax
    MouseMonoclonal option50-100 μg initial0, 14, 28 daysAlum/CFA/IFA
    LlamaSingle-domain nanobodies250-500 μg initial0, 21, 42, 63 daysGerbu/Montanide
  • Screening and validation methods:

    • ELISA against purified protein and peptide antigens

    • Western blot against recombinant protein and native extracts

    • Immunoprecipitation efficiency testing

    • Immunofluorescence microscopy with overexpression controls

    • Specificity validation in knockout/knockdown systems

  • Monoclonal vs. polyclonal considerations:

    • Polyclonal: Better for detection applications, potentially higher avidity

    • Monoclonal: Superior specificity, renewable resource, consistent performance

    • Recombinant antibodies: Reproducibility across laboratories

  • Epitope mapping and characterization:

    • Peptide array screening

    • Hydrogen-deuterium exchange with antibody binding

    • Cross-reactivity assessment with related proteins

    • Binding kinetics determination via surface plasmon resonance

When developing antibodies against YPDSF_1370, special consideration should be given to the conformational epitopes that may be detergent-sensitive, potentially requiring stabilized protein preparations in nanodiscs or amphipols for optimal results.

What bioinformatic approaches can predict functional sites in YPDSF_1370 to guide experimental design?

Comprehensive bioinformatic analysis of YPDSF_1370 can guide experimental design by identifying potential functional sites and regions of interest:

  • Sequence-based predictions:

    • Conservation analysis across bacterial species

    • Identification of conserved domains or motifs

    • Disorder prediction to identify flexible regions

    • Post-translational modification site prediction

  • Structural bioinformatics:

    • Homology modeling using related structures as templates

    • AlphaFold2 structure prediction

    • Molecular dynamics simulations to identify stable conformations

    • Binding site prediction using cavity detection algorithms

  • Evolutionary analysis:

    • Residue co-evolution analysis to predict functional coupling

    • Rate of evolution analysis to identify constrained sites

    • Positive selection detection for host-interaction surfaces

    • Phylogenetic profiling for functional inference

  • Network-based approaches:

    • Gene neighborhood analysis in bacterial genomes

    • Co-expression network integration

    • Protein-protein interaction prediction

    • Functional association networks (STRING database)

  • Integration of prediction results:

    Analysis TypePrediction ToolOutputApplication to YPDSF_1370
    Transmembrane topologyTMHMM, PhobiusTM helix locationsTarget soluble domains for antibody generation
    Conserved domainsInterPro, CDDFunctional domainsDesign truncation constructs
    Binding site predictionFTSite, CASTpPotential ligand sitesDesign site-directed mutagenesis
    Electrostatic surfaceAPBS, PyMOLCharged patchesIdentify potential interaction interfaces
    Molecular dynamicsGROMACS, NAMDFlexible regionsDesign stabilizing mutations

The integration of multiple bioinformatic approaches increases prediction confidence and provides a more comprehensive understanding of potential functional regions in YPDSF_1370, thereby focusing experimental efforts on the most promising targets.

How can researchers troubleshoot common issues in recombinant YPDSF_1370 expression and purification?

Troubleshooting recombinant membrane protein expression and purification requires a systematic approach to identify and resolve specific issues:

  • Low expression yield troubleshooting:

    • Problem: Protein toxicity to expression host

    • Solution: Use tightly controlled inducible promoters, lower induction temperature (16-20°C), test different host strains (C41/C43 for E. coli)

    • Problem: Protein aggregation during expression

    • Solution: Co-express with chaperones, add stabilizing agents (glycerol, specific ions), optimize induction conditions

  • Purification challenges:

    • Problem: Poor binding to affinity resin

    • Solution: Verify tag accessibility, optimize detergent concentration, adjust buffer ionic strength

    • Problem: Co-purifying contaminants

    • Solution: Add intermediate ion exchange step, optimize wash conditions, consider dual tagging strategy

  • Protein stability issues:

    • Problem: Aggregation during concentration

    • Solution: Use additive screen to identify stabilizers, keep concentration below critical threshold, concentrate in presence of substrate/ligand

    • Problem: Activity loss during storage

    • Solution: Test cryoprotectants, optimize buffer composition, consider flash-freezing small aliquots

  • Quality assessment failures:

    • Problem: Multiple bands on SDS-PAGE

    • Solution: Test protease inhibitors, verify for proteolytic sensitive sites, consider native PAGE

    • Problem: Poor purity despite affinity purification

    • Solution: Implement additional purification steps, optimize detergent/salt concentrations, consider on-column washing strategies

For YPDSF_1370 specifically, optimization of detergent selection is critical, as inappropriate detergents can lead to protein aggregation or denaturation despite successful expression .

What considerations are important when designing YPDSF_1370 constructs for different experimental objectives?

Optimal construct design for YPDSF_1370 depends significantly on specific experimental objectives:

  • Structural biology constructs:

    • Truncation of flexible termini based on disorder prediction

    • Thermostabilizing mutations (identified via alanine scanning)

    • Fusion to crystallization chaperones (T4 lysozyme, BRIL)

    • Optimization of purification tags (position, cleavage sites)

  • Functional characterization constructs:

    • Full-length protein with minimal modifications

    • Careful tag placement to avoid functional interference

    • Site-directed mutagenesis of predicted functional residues

    • Fluorescent protein fusions with optimized linkers

  • Protein-protein interaction constructs:

    • Split reporter protein fusions (luciferase, GFP)

    • Proximity labeling tags (BioID, APEX)

    • Pull-down compatible tags (Twin-Strep, FLAG)

    • Consideration of tag interference with interaction surfaces

  • Expression system-specific adaptations:

    Expression SystemCodon OptimizationSignal SequenceSpecial Considerations
    E. coliRequiredpelB or ompA for periplasmic targetingConsider fusion partners (MBP, SUMO)
    YeastRecommendedα-factor for secretionOptimize for GC content
    Insect cellsOptionalgp67 or nativeVerify glycosylation sites
    Mammalian cellsOptionalNative or tPAConsider Kozak sequence optimization
  • Experimental application-specific tags:

    • Crystallography: Minimal tags, thermostabilizing mutations

    • Cryo-EM: GFP fusion for particle picking

    • Cellular localization: Small epitope tags or fluorescent proteins

    • Purification scale-up: Dual affinity tags with protease cleavage sites

Careful bioinformatic analysis of YPDSF_1370 sequence and structure prediction should guide construct design decisions to maximize experimental success .

How can researchers effectively reconstitute purified YPDSF_1370 into membrane mimetics for functional studies?

Reconstitution of purified YPDSF_1370 into membrane mimetic systems is critical for maintaining native conformation and function:

  • Proteoliposome reconstitution:

    • Optimal lipid composition: E. coli total lipid extract or POPE:POPG (3:1) to mimic bacterial membranes

    • Protein-to-lipid ratio optimization (typically 1:100 to 1:1000 w/w)

    • Detergent removal methods:

      • Dialysis (gentle but time-consuming)

      • Bio-Beads SM-2 adsorption (efficient but risk of protein adsorption)

      • Cyclodextrin complexation (rapid but expensive)

    • Functional validation: orientation assays, leakage tests

  • Nanodiscs preparation:

    • MSP selection based on protein size (MSP1D1 for smaller membrane segments)

    • Optimization of MSP:lipid:protein ratios

    • Assembly monitoring via size exclusion chromatography

    • Advantages: defined size, accessibility to both membrane faces

  • Polymer-based systems:

    • Amphipols (A8-35): gentle trapping of membrane proteins

    • SMALPs (styrene-maleic acid lipid particles): direct extraction from membranes

    • Protocol adaptation: careful detergent exchange followed by polymer addition

  • Quality control for reconstituted systems:

    MethodInformation ObtainedSample Requirement
    Dynamic light scatteringSize distribution, homogeneity50-100 μL at 0.1-0.5 mg/mL
    Negative-stain EMVisual confirmation of incorporation5 μL at 0.05-0.1 mg/mL
    Sucrose density gradientIncorporation efficiency200-500 μL sample
    Fluorescence quenchingProtein orientationLabeled protein sample
    Circular dichroismSecondary structure retention200 μL at 0.1-0.2 mg/mL
  • Functional validation approaches:

    • Ligand binding assays with reconstituted protein

    • Ion flux measurements using fluorescent indicators

    • Patch-clamp electrophysiology for channel activity

    • FRET-based conformational change detection

The choice of membrane mimetic system should be guided by the specific downstream applications, with proteoliposomes preferred for transport assays, nanodiscs for structural studies, and amphipols for maintaining stability during biophysical characterization.

How should researchers interpret contradictory results between different experimental approaches studying YPDSF_1370?

When faced with contradictory results in YPDSF_1370 research, a systematic analytical framework helps resolve discrepancies:

  • Technical vs. biological contradictions:

    • Evaluate reproducibility within each method

    • Assess technical variables (buffer conditions, detergents, tags)

    • Consider biological context differences (in vitro vs. in vivo)

    • Determine statistical power of each experimental approach

  • Hierarchical evidence assessment:

    • Rank evidence based on methodological robustness

    • Prioritize direct measurements over inferred properties

    • Consider native vs. recombinant protein differences

    • Evaluate proximity to physiological conditions

  • Resolution strategies:

    • Design bridging experiments addressing specific contradictions

    • Apply orthogonal techniques to validate contested findings

    • Perform structure-function correlation analysis

    • Collaborative cross-validation with independent laboratories

  • Common sources of contradictions for membrane proteins:

    • Detergent-induced conformational changes altering function

    • Tag interference with protein properties

    • Expression system-specific post-translational modifications

    • Oligomerization state differences between methods

  • Systematic contradiction resolution framework:

    • Standardize experimental conditions across methods

    • Isolate and test individual variables systematically

    • Implement blind testing protocols to reduce bias

    • Develop quantitative models that might reconcile seemingly contradictory data

When researching poorly characterized proteins like YPDSF_1370, apparent contradictions often reflect complementary aspects of complex biological systems rather than experimental failures, and their resolution frequently leads to deeper mechanistic insights.

What statistical approaches are most appropriate for analyzing YPDSF_1370 interaction and functional data?

Statistical analysis of membrane protein interaction and functional data requires specialized approaches due to unique experimental challenges:

  • Binding and interaction data analysis:

    • Nonlinear regression for equilibrium binding (one-site, two-site models)

    • Global fitting of multiple datasets with shared parameters

    • Bootstrap analysis for confidence interval estimation

    • Scatchard and Hill plot transformations for cooperativity assessment

  • Activity assay statistical considerations:

    • Michaelis-Menten kinetics evaluation with appropriate software

    • Time-course analysis using area-under-curve comparisons

    • Outlier identification and handling (ROUT method, Q-test)

    • Normalization strategies for batch comparisons

  • High-throughput data analysis:

    • False discovery rate control for multiple comparisons

    • Principal component analysis for dimensionality reduction

    • Hierarchical clustering for interaction pattern identification

    • Network analysis for interpreting complex interactomes

  • Appropriate statistical tests by data type:

    Data TypeRecommended TestsAssumptionsSample Size Requirements
    Dose-responseNon-linear regression, EC50 comparisonSigmoid response relationshipMinimum 7-8 concentrations
    Multiple condition comparisonANOVA with post-hoc testsNormal distribution, equal variance≥5 replicates per condition
    Timecourse experimentsRepeated measures ANOVA, AUC comparisonSphericity, complete datasets≥4 timepoints with replicates
    Binding kineticsGlobal fitting, Bayesian parameter estimationModel appropriatenessMultiple concentrations
  • Validation and robustness assessment:

    • Cross-validation for predictive models

    • Sensitivity analysis for parameter robustness

    • Power analysis for experimental design validation

    • Monte Carlo simulations for error propagation assessment

When analyzing YPDSF_1370 data, special consideration should be given to the higher variability inherent in membrane protein experiments, potentially requiring larger sample sizes and more conservative statistical thresholds than soluble protein studies.

What are the most promising future research directions for understanding YPDSF_1370 function in Yersinia pestis?

The study of YPDSF_1370 represents an important opportunity to deepen our understanding of Yersinia pestis membrane biology and potentially uncover novel therapeutic targets. Future research directions should focus on:

  • Structural biology initiatives:

    • High-resolution structure determination via cryo-EM or X-ray crystallography

    • Molecular dynamics simulations to identify functional movements

    • Structure-guided drug design targeting potential binding pockets

    • Comparative structural analysis with homologs from non-pathogenic bacteria

  • Functional characterization:

    • Comprehensive mutagenesis to map structure-function relationships

    • In vivo infection models with YPDSF_1370 variants

    • Interactome mapping within the bacterial membrane

    • Integration into known virulence networks

  • Translational applications:

    • Evaluation as diagnostic biomarker

    • Assessment as vaccine component

    • Drug target validation studies

    • Development of protein-based biosensors

  • Systems biology integration:

    • Multi-omics approaches during infection progression

    • Network analysis with established virulence factors

    • Comparative analysis across Yersinia species

    • Host-pathogen interface mapping

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.