Recombinant Yersinia pestis UPF0208 membrane protein YPDSF_1972 (YPDSF_1972)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
YPDSF_1972; UPF0208 membrane protein YPDSF_1972
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
YPDSF_1972
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YPDSF_1972 and what is its significance in Yersinia pestis biology?

YPDSF_1972 is an integral membrane protein belonging to the UPF0208 family found in Yersinia pestis, the causative agent of plague. As a membrane protein, it is part of the approximately 25% of the proteome that consists of alpha-helical integral membrane proteins across all organisms . Though specific functions are still being elucidated, membrane proteins like YPDSF_1972 often play crucial roles in bacterial virulence, similar to well-characterized Y. pestis factors such as the F1 antigen . For comprehensive study, researchers should analyze both the protein's structure and potential interactions with other virulence factors in Y. pestis.

What expression systems are recommended for recombinant YPDSF_1972 production?

The expression of full-length membrane proteins presents significant challenges due to their hydrophobic nature and potential toxicity to host cells . For YPDSF_1972, researchers should consider multiple expression systems:

Expression SystemAdvantagesLimitationsRecommended for YPDSF_1972
E. coliCost-effective, high yield, rapid growthMay not properly fold complex membrane proteinsInitial screening, structural studies
Yeast (P. pastoris)Better for eukaryotic post-translational modificationsLonger production timeFunctional studies
Mammalian cellsNative-like folding environmentExpensive, lower yieldsInteraction studies with host proteins
Cell-free systemsAvoids toxicity issuesLimited scaleDifficult-to-express variants

When working with YPDSF_1972, optimization of codon usage is critical as expression challenges may arise from rare codons, particularly given Y. pestis' different codon bias compared to common expression hosts .

What purification strategy yields optimal results for YPDSF_1972?

For effective purification of YPDSF_1972, a multi-step approach similar to those used for other Y. pestis proteins is recommended. Based on established protocols for membrane proteins:

  • Begin with ammonium sulfate fractionation to preliminarily separate the protein from cellular components, similar to methods used for F1 antigen .

  • Follow with membrane solubilization using appropriate detergents compatible with downstream applications.

  • Employ affinity chromatography using fusion tags at both N and C termini to ensure selection of full-length protein only.

  • Conduct FPLC gel filtration chromatography for final purification and assessment of oligomeric state .

Importantly, when eluting YPDSF_1972 during affinity chromatography, use increasing imidazole concentration gradients to distinguish full-length protein from truncated products that may result from translation initiation problems .

How does YPDSF_1972 associate with the bacterial membrane and what insertion mechanism is involved?

The insertion of YPDSF_1972 into the membrane likely follows established membrane protein biogenesis pathways. According to the unifying model of membrane protein biogenesis, the insertion pathway depends on the topology and flanking regions of transmembrane domains:

YPDSF_1972, as a membrane protein, would be inserted through either:

  • The Oxa1 pathway if its transmembrane domains are flanked by short translocated segments

  • The SecY channel if transmembrane domains are flanked by long translocated segments

For experimental determination, researchers should design topology mapping studies using reporter fusions or accessibility assays. The insertion mechanism can be further elucidated through ribosome profiling during translation to determine if membrane-proximal protein synthesis occurs, which facilitates co-translational insertion of multi-TMD proteins .

What structural characteristics influence YPDSF_1972 oligomerization and function?

Membrane proteins frequently function in multimeric assemblies. For YPDSF_1972, researchers should investigate oligomerization patterns similar to those observed in other Y. pestis proteins like the F1 antigen. Studies on F1 have shown that recombinant proteins can exist as multimers of high molecular mass, and this multimeric structure significantly impacts function .

To investigate YPDSF_1972 oligomerization:

  • Employ FPLC gel filtration chromatography to determine native molecular weight

  • Use capillary electrophoresis to assess purity and heterogeneity of oligomeric forms

  • Apply circular dichroism to monitor reassociation of monomeric forms into multimers under various conditions

  • Test both monomeric and multimeric forms in functional assays to determine structure-function relationships

Notably, in studies with F1 antigen, mice immunized with multimeric forms showed significantly better protection against Y. pestis challenge than those immunized with monomeric forms (5/7 vs 1/7 survival rate) . Such differential activity might also apply to YPDSF_1972 if it exists in multiple oligomeric states.

What technical challenges arise when performing structural studies on YPDSF_1972?

Structural characterization of membrane proteins like YPDSF_1972 presents unique challenges that researchers must address:

TechniqueChallenges with YPDSF_1972Potential Solutions
X-ray crystallographyDifficulty obtaining diffraction-quality crystalsUtilize fusion partners to aid crystallization; screen extensive detergent conditions
Cryo-EMSample heterogeneity; detergent interferenceApply GraFix method to stabilize complexes; use amphipol instead of detergents
NMR spectroscopySize limitations; poor spectral resolutionFocus on specific domains; use selective isotopic labeling
Computational predictionMulti-domain complexityEmploy AI-based structure prediction tools like AlphaFold2

When preparing samples for these techniques, ensuring the maintenance of the native oligomeric state during purification is crucial. Researchers should monitor whether YPDSF_1972 dissociates after heating in the presence of SDS and whether reassociation occurs upon SDS removal, similar to observations with F1 antigen .

How can researchers effectively compare YPDSF_1972 variants across different Y. pestis strains?

Comparative analysis of YPDSF_1972 across Y. pestis strains provides valuable evolutionary and functional insights. A systematic approach includes:

  • Sequence alignment to identify conserved regions versus variable domains

  • Expression of variant proteins using identical systems to control for expression artifacts

  • Functional comparison through standardized assays

  • Structural analysis to determine if variations affect folding or oligomerization

Present findings in a comparative table format rather than lists to highlight trends and patterns in the data across strains :

Y. pestis StrainYPDSF_1972 Sequence VariationExpression LevelMembrane LocalizationFunctional Activity
KIMReference sequence+++++Primarily membraneBaseline activity
CO92Variations noted in position X++++Membrane and cytosolic85% of reference
AngolaVariations in transmembrane domain+++Primarily membrane110% of reference
[Additional strains][Corresponding data][Data][Data][Data]

What controls are essential when conducting expression studies with YPDSF_1972?

When designing experiments to express and characterize YPDSF_1972, incorporate these critical controls:

  • Positive expression control: A well-characterized membrane protein known to express in your system

  • Negative expression control: Empty vector to establish baseline expression patterns

  • Toxicity assessment: Growth curve comparison between YPDSF_1972-expressing cells and controls

  • Localization controls: Fractionation quality controls to confirm proper separation of membrane fractions

  • Expression validation: Western blot analysis with both N-terminal and C-terminal tag antibodies to confirm full-length expression

When experiencing expression challenges, troubleshoot by analyzing the protein sequence and secondary structure, then adopt optimization strategies accordingly. For hydrophobic proteins like YPDSF_1972, expression may be affected by protein hydrophilicity, codon rarity, and protein toxicity to the host system .

How should researchers design functional assays for a protein with unknown function like YPDSF_1972?

Designing functional assays for poorly characterized proteins requires a systematic approach:

  • Conduct bioinformatic analysis to identify structural homologs with known functions

  • Perform protein-protein interaction studies to identify binding partners

  • Create gene knockout or knockdown models to observe phenotypic changes

  • Develop in vitro assays based on predicted biochemical properties

When testing multiple hypotheses about YPDSF_1972 function, organize your experimental approach as follows:

Functional HypothesisExperimental ApproachRequired ControlsExpected Results if Hypothesis Correct
Virulence factorAnimal infection models with wild-type vs. YPDSF_1972 knockoutComplementation controlReduced virulence in knockout
Transport proteinLiposome reconstitution with substrate flux measurementEmpty liposomes; known transporterSubstrate-specific transport
Structural roleMembrane integrity assaysKnockouts of known structural proteinsMembrane defects in absence of protein
Signaling functionPhosphorylation/binding partner assaysInactive mutant versionsSpecific phosphorylation or binding events

How should researchers resolve contradictory findings regarding YPDSF_1972 structure or function?

When facing contradictory experimental results:

  • Methodically evaluate experimental conditions that might lead to different outcomes

  • Consider the possibility that YPDSF_1972 has context-dependent functions or conformations

  • Investigate whether purification methods affect the protein's native state

  • Examine whether different domains of the protein might have distinct functions

Organize contradictory findings in a comparison table that highlights methodology differences:

StudyReported FunctionExperimental ConditionsPurification MethodOligomeric StatePossible Explanation for Discrepancy
Study ATransport activitypH 6.8, membrane vesiclesDetergent X, tag-freeDimericpH-dependent activity
Study BNo transport activitypH 7.4, reconstituted liposomesDetergent Y with His-tagMonomericOligomeric state requirement for function
Study CStructural role onlyIn vivo studiesN/AUnknownDifferent cellular context

What statistical approaches are most appropriate for analyzing YPDSF_1972 functional data?

Select statistical methods based on your experimental design and data characteristics:

Experiment TypeRecommended Statistical ApproachRationaleImplementation Notes
Expression optimizationFactorial ANOVAEvaluates multiple factors simultaneouslyInclude temperature, induction time, and media as factors
Structure-function correlationsMultiple regressionRelates structural parameters to activityEnsure multicollinearity is addressed
Protein-protein interactionsBinding curve analysis with non-linear regressionAppropriate for saturation binding dataReport both Kd and Bmax values
Comparative strain analysisHierarchical clustering with heatmap visualizationIdentifies patterns across multiple variablesStandardize values before clustering

Avoid simple statistical comparisons that fail to account for the complexity of membrane protein behavior. Instead, employ multivariate approaches that can handle the interdependencies common in biological systems.

How can researchers overcome common challenges in recombinant YPDSF_1972 expression and purification?

Membrane proteins like YPDSF_1972 present specific technical challenges that require systematic troubleshooting:

ChallengeDiagnostic IndicatorsSolution ApproachesValidation Method
Low expression yieldMinimal band on Western blotCodon optimization; lower induction temperature; specialized host strainsQuantitative Western blot
Inclusion body formationProtein in insoluble fractionFusion with solubility tags; alternative detergents; refolding protocolsMembrane fraction analysis
Truncated productsMultiple bands below expected sizeDual N/C terminal tags; increased imidazole during elution ; protease inhibitorsMass spectrometry verification
Loss of native conformationReduced function in activity assaysGentle purification conditions; stability screeningCircular dichroism comparison
Aggregation during concentrationVisible precipitate; size exclusion profile shiftAddition of stabilizing agents; alternative concentration methodsDynamic light scattering

When working with transmembrane proteins like YPDSF_1972, it's particularly important to verify that the protein maintains its proper conformation and oligomeric state throughout purification, as these properties often directly relate to function .

What emerging technologies will advance YPDSF_1972 research?

Several cutting-edge approaches are poised to enhance our understanding of membrane proteins like YPDSF_1972:

  • AI-based structure prediction tools like AlphaFold2 can provide detailed insights into the three-dimensional structure of YPDSF_1972, accelerating experimental design and function hypothesis development .

  • Advanced cryo-EM techniques allow structural determination of membrane proteins in near-native environments without crystallization, potentially revealing dynamic conformational states.

  • Nanodiscs and cell-derived membrane mimetics offer improved systems for functional studies by maintaining a more native-like lipid environment.

  • CRISPR-based approaches enable precise genomic modification to study YPDSF_1972 function in the native Y. pestis context.

  • Integrative structural biology approaches combining multiple techniques (X-ray, NMR, mass spectrometry, SAXS) can overcome the limitations of individual methods.

For innovative research on YPDSF_1972, combining these emerging technologies with established approaches will likely yield the most comprehensive insights into this membrane protein's biology and potential role in Y. pestis pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.