Recombinant Yersinia pestis UPF0259 membrane protein YPDSF_0935 (YPDSF_0935)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Gene and expression:

  • Encoded by the ordered locus YPDSF_0935 in Yersinia pestis (strain Pestoides F) .

  • Recombinant expression system: Produced in a bacterial host, with optimized codon usage for high-yield expression.

Physicochemical properties:

PropertyDetail
Molecular weight~29 kDa (calculated)
Storage-20°C (short-term), -80°C (long-term)
StabilityAvoid repeated freeze-thaw cycles

Functional and Biological Context

While YPDSF_0935’s specific role remains uncharacterized, insights can be inferred from related Yersinia membrane proteins:

  • Membrane localization: Likely embedded in the bacterial outer membrane, a common feature of UPF0259 family proteins. Such proteins often contribute to nutrient uptake, stress response, or host-pathogen interactions .

  • Stress adaptation: Transcriptional profiling of intracellular Y. pestis reveals upregulation of membrane proteins during macrophage infection, suggesting roles in surviving oxidative stress or nutrient acquisition .

  • Vaccine relevance: Although not directly studied, recombinant membrane proteins like F1 and LcrV are critical in plague vaccine formulations . YPDSF_0935 could serve as a novel antigen candidate for vaccine development, particularly against F1-negative Y. pestis strains .

Research Applications

Current uses:

  • Antibody production: Utilized as an immunogen to generate polyclonal or monoclonal antibodies for Western blotting, ELISA, or immunohistochemistry .

  • Protein interaction studies: Potential use in pull-down assays to identify binding partners in host cells or bacterial membranes.

Future directions:

  • Vaccine adjuvants: Combining YPDSF_0935 with established antigens (e.g., F1-V) could broaden protection against diverse Y. pestis strains .

  • Structural biology: Solving its 3D structure via cryo-EM or X-ray crystallography may elucidate mechanistic roles in bacterial virulence.

Comparative Analysis with Other Y. pestis Antigens

ProteinFunctionVaccine Utility
F1 antigenCapsular proteinCore component of subunit vaccines
LcrVType III secretion system tip proteinNeutralizes virulence
YPDSF_0935Uncharacterized membrane proteinPotential novel antigen

Challenges and Limitations

  • Functional ambiguity: The lack of published studies on YPDSF_0935 limits its application in targeted therapies.

  • Strain specificity: Derived from the Pestoides F strain, which may exhibit genetic differences from other Y. pestis lineages .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
YPDSF_0935; UPF0259 membrane protein YPDSF_0935
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
YPDSF_0935
Target Protein Sequence
MPITANTLYRDSFNFLRNQIAAILLLALLTAFITVMLNQTFMPASEQLSILSIPENDITS SGNLSISEIVSQMTPEQQMVLLRVSAVATFSALVGNVLLVGGLLTLIAMVSQGRRVSALQ AIGLSLPILPRLLVLMFISTLVIQLGLTFFIVPGVAIAIALSLSPIIVTNERMGIFAAMK ASAQLAFANVRLIVPAMMLWIAVKLLLLFLISRFTVLPPTIATIVLSTLSNLASALLLVY LFRLYMLLRPVSLDKQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0259 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Yersinia pestis UPF0259 membrane protein YPDSF_0935?

Recombinant Yersinia pestis UPF0259 membrane protein YPDSF_0935 (UniProt ID: A4TJ73) is a full-length (256 amino acid) protein derived from the plague bacterium Yersinia pestis. This protein belongs to the UPF0259 membrane protein family and is typically expressed in E. coli expression systems with an N-terminal His tag to facilitate purification. The recombinant form allows researchers to study the protein's characteristics without handling live Yersinia pestis, which requires high biosafety level facilities. The protein is part of the membrane proteome of Y. pestis, the causative agent of plague, which manifests in bubonic, septicemic, and pneumonic forms .

For effective research applications, the recombinant protein is typically purified to greater than 90% purity as determined by SDS-PAGE techniques. The highly purified nature of this preparation makes it suitable for a wide range of experimental applications including structural studies, functional characterization, and immunological analyses .

How should YPDSF_0935 be stored and reconstituted for optimal research use?

For optimal stability and research applications, YPDSF_0935 requires specific storage and reconstitution protocols. The protein is typically supplied as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0. This formulation helps maintain protein integrity during freeze-drying and storage .

For storage:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can lead to protein denaturation

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

  • Aliquot the reconstituted protein for storage at -20°C/-80°C

Storage ConditionRecommendationDuration
Lyophilized form-20°C/-80°CLong-term
Reconstituted (no glycerol)4°CUp to one week
Reconstituted (with 50% glycerol)-20°C/-80°CLong-term

These storage guidelines are critical for maintaining protein activity and structural integrity, especially for membrane proteins which tend to be less stable than soluble proteins in solution.

How might YPDSF_0935 relate to other protective membrane proteins in Yersinia pestis?

While the specific function of YPDSF_0935 membrane protein has not been fully characterized, researchers can draw insights from studies of other Yersinia pestis membrane proteins. Several outer membrane proteins have demonstrated protective potential against plague, including Ail/OmpX, Pla (plasminogen-activating protease), and OmpA .

Studies have shown that antibodies against these membrane proteins can provide protection in animal models of plague. For instance, antibodies to Ail and OmpA protected mice against bubonic plague when challenged with an F1-negative strain of Y. pestis CO92, while Pla antibodies were protective against pneumonic plague. In rat models, antibodies to Ail specifically provided protection against pneumonic plague after wild-type CO92 challenge .

Research examining YPDSF_0935 could investigate whether this membrane protein shares similar protective properties. Experimental approaches might include:

  • Generating specific antibodies against YPDSF_0935 and testing their protective efficacy in animal models

  • Comparing sequence and structural homology between YPDSF_0935 and known protective antigens

  • Examining YPDSF_0935 expression levels during different stages of infection

  • Investigating potential interactions between YPDSF_0935 and host immune components

These approaches could help position YPDSF_0935 in the context of Yersinia pestis virulence and potential vaccine development strategies that currently focus on F1 and V antigens but seek to incorporate additional protective antigens .

What methodological approaches are recommended for functional characterization of YPDSF_0935?

Functional characterization of YPDSF_0935 requires a multi-faceted approach that addresses both structural properties and biological activities. Based on established methodologies for similar membrane proteins, researchers should consider the following strategies:

  • Structural Analysis:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis combined with mass spectrometry to identify exposed regions

    • Crystallography or cryo-electron microscopy for high-resolution structure determination (though challenging for membrane proteins)

  • Localization Studies:

    • Immunogold electron microscopy to confirm membrane localization

    • Cell fractionation followed by Western blotting to determine precise membrane association

    • Fluorescent protein tagging for in vivo visualization

  • Protein-Protein Interaction Analysis:

    • Co-immunoprecipitation to identify binding partners

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Cross-linking studies followed by mass spectrometry

  • Functional Assays:

    • Gene knockout or knockdown studies to assess phenotypic changes

    • Complementation assays to confirm functional roles

    • Host cell interaction assays to evaluate potential roles in pathogenesis

For each methodological approach, researchers should include appropriate controls and statistical analyses to ensure robust data interpretation. When publishing results, data should be presented in well-structured tables following established guidelines for scientific data presentation .

How does YPDSF_0935 compare to established protective antigens like F1-V in Yersinia pestis research?

The F1-V fusion protein has emerged as a leading candidate antigen for plague vaccine development, showing significant protection against aerosol challenge with Y. pestis in murine studies . In contrast, YPDSF_0935 remains less characterized in terms of its potential as a protective antigen.

Comparative analysis between YPDSF_0935 and F1-V should consider:

  • Immunogenicity Profiles:

    • F1-V has demonstrated strong immunogenicity and protection in various animal models

    • The immunogenic potential of YPDSF_0935 requires further investigation through antibody response studies

  • Conservation Across Strains:

    • A significant concern with F1-V-based vaccines is their potential inability to protect against F1-negative strains or those with LcrV variants

    • YPDSF_0935 conservation across different Y. pestis strains should be assessed to determine its potential as a broadly protective antigen

  • Prime-Boost Vaccination Potential:

    • F1-V has been studied in various prime-boost regimens with demonstrated efficacy

    • YPDSF_0935 could potentially be evaluated in combination with F1-V or other antigens in prime-boost strategies

  • Protective Mechanism:

    • F1-V protection correlates with antibody responses

    • YPDSF_0935's protective mechanism, if any, would need to be determined through passive transfer studies similar to those conducted for other membrane proteins

AntigenConservation Across StrainsProtection Against F1- StrainsStage of Research
F1-VHigh, but concerns with F1- strainsLimitedAdvanced (clinical trials)
Ail/OmpXHighDemonstrated in mice (bubonic)Preclinical
PlaHighDemonstrated in mice (pneumonic)Preclinical
OmpAHighDemonstrated in mice (bubonic)Preclinical
YPDSF_0935To be determinedTo be determinedEarly investigational

Research into YPDSF_0935 could potentially address the limitations of current vaccine candidates, particularly if it proves to be highly conserved and protective against a wide variety of Y. pestis strains.

What expression systems and purification strategies are most effective for YPDSF_0935?

Effective expression and purification of membrane proteins like YPDSF_0935 present significant challenges due to their hydrophobic nature and requirements for proper folding. Based on established protocols for recombinant YPDSF_0935 and similar membrane proteins, the following methodological approaches are recommended:

Expression Systems:

  • E. coli-based expression: The most commonly used system for YPDSF_0935, utilizing E. coli strains optimized for membrane protein expression such as C41(DE3), C43(DE3), or Lemo21(DE3) .

  • Vector selection: pET-based vectors with N-terminal His-tags have proven effective for YPDSF_0935 expression and subsequent purification.

  • Induction conditions: Low-temperature induction (16-18°C) with reduced IPTG concentrations (0.1-0.5 mM) often improves membrane protein folding and reduces inclusion body formation.

  • Media optimization: Addition of glycerol (0.5-1%) and specific ions can enhance membrane protein expression.

Purification Strategy:

  • Membrane isolation: Differential centrifugation followed by membrane solubilization using detergents.

  • Detergent selection: Screen multiple detergents (DDM, LDAO, OG) for optimal YPDSF_0935 solubilization.

  • Immobilized metal affinity chromatography (IMAC): Utilizing the N-terminal His-tag for initial purification .

  • Size exclusion chromatography: Further purification to obtain homogeneous protein preparations.

  • Quality control: SDS-PAGE analysis confirms >90% purity, with Western blotting to verify identity .

For researchers attempting to express and purify YPDSF_0935, it is crucial to monitor protein quality throughout the process. Circular dichroism spectroscopy can confirm proper folding, while dynamic light scattering assesses protein homogeneity and aggregation state. For functional studies, purified protein should be reconstituted into liposomes or nanodiscs to provide a membrane-like environment.

How can researchers design experiments to investigate potential immunoprotective properties of YPDSF_0935?

Investigating the immunoprotective potential of YPDSF_0935 requires a systematic experimental approach similar to those used for other Y. pestis antigens. The following experimental design provides a methodological framework:

Phase 1: Immunogenicity Assessment

  • Animal immunization: Immunize mice or rats with purified recombinant YPDSF_0935, using appropriate adjuvants.

  • Antibody response analysis: Measure antibody titers using ELISA and characterize antibody subtypes (IgG1, IgG2a, etc.).

  • T-cell response assessment: Analyze T-cell proliferation and cytokine profiles following stimulation with the antigen.

Phase 2: Protection Studies

  • Challenge models: Test protection against different forms of plague:

    • Bubonic model: Subcutaneous challenge

    • Pneumonic model: Aerosol challenge

  • Strain variation: Include both wild-type and F1-negative Y. pestis strains in challenge studies .

  • Passive transfer studies: Investigate whether protective immunity is antibody-mediated by transferring serum from immunized animals to naive recipients .

Phase 3: Comparative and Combination Studies

  • Prime-boost strategies: Test YPDSF_0935 in homologous and heterologous prime-boost regimens .

  • Combinatorial approaches: Evaluate YPDSF_0935 in combination with established antigens like F1-V or other membrane proteins (Ail, Pla, OmpA) .

  • Route comparison: Compare different immunization routes (subcutaneous, intranasal, intramuscular) for optimal protection .

Experimental PhaseKey MethodsData CollectionAnalysis Approach
ImmunogenicityELISA, Flow cytometry, ELISpotAntibody titers, T-cell profilesComparison to established antigens
ProtectionAnimal challenge studiesSurvival rates, bacterial burdenKaplan-Meier survival analysis
Comparative/CombinationPrime-boost, antigen combinationsProtection rates, immunological correlatesMultifactorial analysis

These experimental approaches should include appropriate controls, such as animals immunized with adjuvant only or with established protective antigens as positive controls. Statistical analysis should be rigorous, with animal studies powered sufficiently to detect meaningful differences in protection .

What analytical methods are most appropriate for studying YPDSF_0935 integration in membrane systems?

Studying membrane protein integration requires specialized analytical approaches. For YPDSF_0935, the following methodological techniques are recommended:

Biophysical Characterization:

  • Differential scanning calorimetry (DSC): Determines thermal stability in different membrane environments.

  • Attenuated total reflection Fourier-transform infrared spectroscopy (ATR-FTIR): Analyzes secondary structure and orientation within membranes.

  • Fluorescence spectroscopy: Using intrinsic tryptophan fluorescence or extrinsic probes to monitor conformational changes upon membrane integration.

  • Surface plasmon resonance (SPR): Measures protein-membrane interactions in real-time.

Microscopy Approaches:

  • Atomic force microscopy (AFM): Visualizes YPDSF_0935 organization in supported lipid bilayers.

  • Cryo-electron microscopy: Provides structural information in near-native environments.

  • FRET-based imaging: Measures proximity between tagged YPDSF_0935 and membrane components.

Functional Integration Assessment:

  • Proteoliposome-based assays: Reconstitute YPDSF_0935 into liposomes to study functional properties.

  • Planar lipid bilayer recordings: Detect potential channel or transport activity.

  • Oriented circular dichroism: Determines protein orientation within the membrane.

Computational Approaches:

  • Molecular dynamics simulations: Model YPDSF_0935 integration and behavior in various membrane environments.

  • Hydrophobicity analysis: Predict membrane-spanning regions and topology.

  • Evolutionary analysis: Compare membrane integration patterns across homologs.

These methods should be applied in a complementary manner, as each provides different insights into membrane protein behavior. Data should be systematically collected and organized according to established guidelines for scientific data presentation, with appropriate controls to validate findings .

How should researchers analyze and resolve contradictory results when studying YPDSF_0935 function?

Systematic Analysis of Contradictions:

  • Methodological Comparison:

    • Compare experimental methodologies in detail, including protein preparation methods, buffer compositions, and assay conditions

    • Create a comprehensive comparison table documenting all methodological differences

    • Identify critical variables that may impact results (e.g., detergent choice, lipid composition, temperature)

  • Reproducibility Assessment:

    • Replicate experiments using standardized protocols across different laboratories

    • Implement blinded analysis to minimize bias

    • Utilize statistical methods appropriate for reproducibility assessment, such as intraclass correlation coefficients

  • Data Integration Approaches:

    • Apply meta-analysis techniques when multiple datasets are available

    • Weight evidence based on methodological rigor and sample size

    • Consider Bayesian approaches to incorporate prior knowledge

  • Experimental Validation:

    • Design critical experiments specifically to address contradictions

    • Include positive and negative controls in all validation experiments

    • Consider orthogonal approaches that can provide complementary evidence

When analyzing contradictions in peer-reviewed literature, researchers should systematically evaluate potential sources of disagreement, similar to approaches used in analyzing scientific peer reviews where expert opinions may differ based on domain knowledge, language proficiency, or expertise .

Source of ContradictionAnalysis ApproachResolution Strategy
Methodological differencesDetailed comparison of protocolsStandardize critical parameters
Expression system variationCompare protein properties from different systemsValidate with native protein when possible
Environmental conditionsSystematic testing of condition effectsDefine optimal condition ranges
Interpretation frameworksEvaluate assumptions in data analysisDevelop consensus analytical approach

The resolution of contradictory results should be documented transparently, acknowledging limitations and uncertainties. This approach aligns with best practices in scientific research and enhances the reliability of findings about YPDSF_0935 function .

What statistical approaches are recommended for analyzing YPDSF_0935 interaction studies?

Statistical analysis of YPDSF_0935 interaction studies requires careful consideration of experimental design, data characteristics, and biological context. The following statistical approaches are recommended for robust analysis:

For Binding and Interaction Studies:

  • Equilibrium binding analysis:

    • Apply non-linear regression to fit binding data to appropriate models (e.g., one-site binding, Hill equation)

    • Calculate and report binding parameters (Kd, Bmax) with confidence intervals

    • Use Scatchard or Lineweaver-Burk plots as complementary visualization tools

  • Kinetic interaction analysis:

    • Employ global fitting algorithms for association/dissociation curves

    • Consider AIC (Akaike Information Criterion) or BIC (Bayesian Information Criterion) for model selection

    • Report kon, koff, and derived Kd values with appropriate error estimates

For Comparative Studies:

  • ANOVA-based approaches:

    • Use one-way or two-way ANOVA for comparing multiple conditions

    • Apply appropriate post-hoc tests (Tukey's, Dunnett's) for multiple comparisons

    • Check ANOVA assumptions and apply transformations if necessary

  • Non-parametric alternatives:

    • Use Kruskal-Wallis followed by Dunn's test when data doesn't meet parametric assumptions

    • Consider permutation tests for complex experimental designs

For High-Dimensional Data:

  • Multivariate analysis:

    • Apply principal component analysis (PCA) to identify patterns in complex datasets

    • Use hierarchical clustering to identify groups of similar interactions

    • Consider partial least squares (PLS) regression for relating interaction data to functional outcomes

Statistical Reporting Standards:

When designing experiments to study YPDSF_0935 interactions, researchers should perform power analysis to determine appropriate sample sizes and plan for sufficient biological and technical replicates to ensure statistical validity. Data should be presented following established guidelines for scientific data presentation, with clear delineation of independent and dependent variables .

How can researchers effectively correlate YPDSF_0935 structural features with potential functional roles?

Establishing structure-function relationships for membrane proteins like YPDSF_0935 requires integrating multiple experimental approaches with computational analysis. The following methodological framework provides a comprehensive strategy:

Experimental Structure-Function Analysis:

  • Site-Directed Mutagenesis:

    • Systematically mutate predicted functional residues

    • Create a mutation panel targeting conserved regions, charged residues, and predicted binding sites

    • Evaluate functional consequences using standardized assays

    • Organize mutation data in structured tables correlating amino acid position, mutation type, and functional effect

  • Domain Mapping:

    • Generate truncated constructs to isolate functional domains

    • Use domain swapping with homologous proteins to identify specificity determinants

    • Create chimeric proteins to map domain interactions

  • Protein Modification Analysis:

    • Identify post-translational modifications using mass spectrometry

    • Determine effects of modifications on function

    • Map modification sites to structural models

Computational Approaches:

  • Homology Modeling:

    • Generate structural models based on homologous proteins

    • Validate models using experimental constraints

    • Update models as new structural data becomes available

  • Molecular Dynamics Simulations:

    • Simulate YPDSF_0935 behavior in membrane environments

    • Identify conformational changes and potential binding sites

    • Correlate dynamic properties with functional hypotheses

  • Evolutionary Analysis:

    • Conduct multiple sequence alignments of homologs

    • Identify conserved residues as potential functional hotspots

    • Apply coevolutionary analysis to detect coupled residues

Integrated Data Analysis:

Researchers should develop a comprehensive database correlating:

  • Structural features (secondary structure elements, domains)

  • Sequence conservation patterns

  • Mutation effects

  • Interaction profiles

  • Predicted functional motifs

Such integrated analysis can reveal structure-function relationships that might not be apparent from individual experiments. For visualization, researchers can generate annotated structural models highlighting functional regions, conservation patterns, and mutation effects.

The correlation between structure and function should be presented in well-structured tables and figures that clearly demonstrate the evidence supporting each proposed functional role .

What are the most promising research directions for YPDSF_0935 studies?

Based on current knowledge of Yersinia pestis membrane proteins and plague pathogenesis, several high-priority research directions emerge for YPDSF_0935 studies. These directions combine fundamental biological questions with potential applications in plague prevention and treatment.

The most promising research trajectories include:

  • Functional Characterization: Determining the precise biological function of YPDSF_0935 in Y. pestis physiology and pathogenesis remains a fundamental question. Approaches combining gene deletion, complementation studies, and phenotypic analysis would provide critical insights into this uncharacterized membrane protein's role.

  • Immunological Significance: Investigating whether YPDSF_0935 could serve as a protective antigen, similar to other Y. pestis membrane proteins like Ail, OmpA, and Pla. This direction is particularly relevant given the limitations of current vaccine candidates based primarily on F1 and V antigens, especially against F1-negative strains .

  • Structural Biology: Solving the three-dimensional structure of YPDSF_0935 would facilitate structure-based functional predictions and potential drug development. While membrane protein structural determination remains challenging, advances in cryo-electron microscopy make this increasingly feasible.

  • Host-Pathogen Interactions: Exploring potential interactions between YPDSF_0935 and host factors could reveal its role in plague pathogenesis. Particularly relevant would be investigations into whether YPDSF_0935 interacts with components of the human immune system.

  • Evolutionary Conservation: Analyzing the conservation of YPDSF_0935 across Yersinia species and strains could provide insights into its evolutionary importance and potential as a broadly protective antigen against diverse Y. pestis isolates.

These research directions should leverage multidisciplinary approaches combining molecular biology, immunology, structural biology, and computational methods. The integration of these diverse perspectives will accelerate understanding of YPDSF_0935 and potentially contribute to improved strategies for plague prevention and treatment .

What methodological advancements would most benefit YPDSF_0935 research?

Advancing research on YPDSF_0935 would benefit significantly from methodological innovations in several key areas. These innovations would address current technical challenges in membrane protein research while enabling more sophisticated functional analyses.

Critical Methodological Advancements:

  • Expression and Purification Technologies:

    • Development of specialized expression systems optimized for challenging membrane proteins

    • Nanoscale purification technologies requiring smaller sample volumes

    • Automation of detergent screening to identify optimal solubilization conditions

    • Membrane mimetic systems (nanodiscs, SMALPs) that better preserve native protein conformation

  • Structural Analysis Methods:

    • Advances in cryo-electron microscopy specifically adapted for membrane proteins

    • Integrative structural biology approaches combining multiple low-resolution techniques

    • High-throughput crystallization screening specialized for membrane proteins

    • Computational methods for more accurate membrane protein structure prediction

  • Functional Characterization Tools:

    • Development of label-free interaction analysis specifically for membrane proteins

    • High-throughput assays for measuring membrane protein function in near-native environments

    • Single-molecule techniques adapted for membrane protein analysis

    • Advanced imaging methods for tracking membrane proteins in live bacteria

  • Genetic Manipulation Systems:

    • Refined CRISPR-Cas9 systems optimized for Y. pestis

    • Inducible expression systems with fine-tuned control for membrane proteins

    • Site-specific incorporation of non-canonical amino acids for biophysical studies

    • Conditional knockout systems for essential membrane proteins

  • Immunological Analysis Platforms:

    • High-throughput epitope mapping technologies

    • Improved animal models that better recapitulate human plague

    • Systems for rapid testing of protective efficacy against diverse Y. pestis strains

    • Single-cell analysis of immune responses to membrane antigens

These methodological advancements would collectively accelerate progress in understanding YPDSF_0935 biology and evaluating its potential as a therapeutic target or vaccine component. Interdisciplinary collaboration between membrane protein biochemists, structural biologists, immunologists, and bioengineers would be essential to realize these technological innovations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.