The YPDSF_0796 protein is annotated as a UPF0283 (conserved protein of unknown function) membrane protein . The precise function of this protein remains unknown, highlighting the need for further research to elucidate its role in Y. pestis biology. Proteins' functions are determined by their shapes, which are determined by their amino acid sequences .
YPDSF_0796 is a 353 amino acid protein. The sequence of the protein is :
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAALKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSVVTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLHETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLIINRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGIGAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
As a membrane protein, YPDSF_0796 is likely embedded in the cell membrane of Y. pestis. Hydrophobic amino acids are typically found in the interior of proteins, while hydrophilic ones are on the surface, allowing the protein to maximize electrostatic interactions5.
Recombinant YPDSF_0796 protein can be produced in Escherichia coli with an N-terminal His tag . The His tag facilitates purification using affinity chromatography . Recombinant protein production enables researchers to study the protein in vitro, develop antibodies, and investigate its potential as a vaccine candidate .
Further studies are required to fully understand the function and significance of YPDSF_0796. Potential research directions include:
Structural determination: Determining the three-dimensional structure of YPDSF_0796 would provide insights into its potential function and interactions with other molecules .
Interaction studies: Identifying the proteins and other molecules that interact with YPDSF_0796 could reveal its role in cellular processes.
Functional assays: Developing in vitro and in vivo assays to assess the activity of YPDSF_0796 could help elucidate its function.
Vaccine potential: Evaluating the potential of YPDSF_0796 as a vaccine candidate could contribute to the development of new strategies for preventing plague .
KEGG: ypp:YPDSF_0796
Computational analyses of YPDSF_0796 predict several transmembrane helices characteristic of integral membrane proteins. The protein belongs to the UPF0283 family, which remains functionally uncharacterized but conserved across bacterial species. The N-terminal region (amino acids 1-40) appears to contain a cytoplasmic domain, followed by multiple transmembrane segments. The protein lacks signal peptides typical of secreted proteins, suggesting it remains embedded in the bacterial membrane .
Predicted structural features include:
Transmembrane helices: Approximately 4-6 segments
Cytoplasmic domains: N-terminal region and internal loops
Extracellular/periplasmic domains: External loops between transmembrane segments
The UPF0283 membrane protein family shows moderate conservation across Yersinia species and related Enterobacteriaceae. Sequence alignment studies reveal approximately 70-85% sequence identity among Yersinia species, with higher conservation in the transmembrane regions compared to loop regions. The protein's conservation pattern suggests functional importance, despite its precise role remaining uncharacterized. Comparative genomics approaches have identified homologs in other pathogenic bacteria, providing opportunities for evolutionary studies and functional inference through homology modeling .
E. coli remains the preferred expression system for recombinant YPDSF_0796 production. Multiple studies have successfully expressed the full-length protein (amino acids 1-353) with an N-terminal His-tag in E. coli systems . For optimal expression, consider the following parameters:
| Expression Parameter | Recommended Condition |
|---|---|
| E. coli strain | BL21(DE3) for standard expression; C41(DE3) or C43(DE3) for membrane proteins |
| Expression vector | pET-based vectors with T7 promoter |
| Induction | 0.5-1.0 mM IPTG at OD600 = 0.6-0.8 |
| Post-induction temperature | 16-18°C for 16-20 hours (reduces inclusion body formation) |
| Media | TB or 2×YT supplemented with glucose may improve yield |
For membrane proteins like YPDSF_0796, detergent solubilization is typically required during purification. Common detergents include n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations above their critical micelle concentration .
A multi-step purification strategy is recommended for obtaining high-purity, functionally active YPDSF_0796:
Membrane fraction isolation: Harvest cells and disrupt by sonication or high-pressure homogenization in buffer containing protease inhibitors. Separate membrane fraction by ultracentrifugation.
Detergent solubilization: Solubilize membrane proteins using appropriate detergents (typically 1% DDM) for 1-2 hours at 4°C with gentle rotation.
Immobilized metal affinity chromatography (IMAC): For His-tagged proteins, apply solubilized fraction to Ni-NTA or similar resin. Wash with 20-40 mM imidazole to reduce non-specific binding, then elute with 250-300 mM imidazole.
Size exclusion chromatography: Further purify using gel filtration (e.g., Superose 6 or Superdex 200) to separate oligomeric states and remove aggregates.
This protocol typically yields protein with >90% purity as determined by SDS-PAGE analysis . For functional studies, verify proper folding using circular dichroism spectroscopy.
For maximum stability and activity retention of recombinant YPDSF_0796, the following storage conditions are recommended:
Short-term storage (1 week): Store working aliquots at 4°C in Tris-based buffer containing detergent above its critical micelle concentration.
Long-term storage: Store at -20°C/-80°C in buffer containing 50% glycerol or 6% trehalose (pH 8.0) to prevent freeze-damage. Aliquoting is necessary to avoid repeated freeze-thaw cycles.
Reconstitution: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Consider adding glycerol to 5-50% final concentration for improved stability .
Experimental evidence has shown that repeated freezing and thawing significantly reduces protein activity and should be strictly avoided . Activity loss typically follows first-order kinetics, with approximately 15-20% loss per freeze-thaw cycle.
Optimized ELISA protocols for detecting YPDSF_0796 in experimental samples typically follow this methodology:
Coating: Coat high-binding ELISA plates with purified anti-YPDSF_0796 antibody (typically 1-5 μg/mL) in carbonate buffer (pH 9.6) overnight at 4°C.
Blocking: Block with 3-5% BSA or non-fat milk in PBS-T (PBS with 0.05% Tween-20) for 1-2 hours at room temperature.
Sample addition: Add experimental samples and standards (recombinant YPDSF_0796 at known concentrations) diluted in blocking buffer. Incubate for 2 hours at room temperature or overnight at 4°C.
Detection antibody: Apply biotinylated detection antibody specific to YPDSF_0796 (typically at 0.5-2 μg/mL) for 1-2 hours at room temperature.
Signal development: Add streptavidin-HRP conjugate followed by appropriate substrate (TMB or ABTS). Measure absorbance at appropriate wavelength.
Sensitivity can be enhanced through amplification steps using avidin-biotin systems. The lower limit of detection typically reaches 0.1-0.5 ng/mL depending on antibody quality and optimization conditions .
Generating effective antibodies against YPDSF_0796 requires careful antigen design and validation:
Antigen design strategies:
Full-length recombinant protein: Best for conformational epitopes but challenging due to hydrophobic domains
Peptide synthesis: Target unique, hydrophilic regions (preferably extracellular loops)
Fusion proteins: Express with carrier proteins (MBP, GST) to enhance immunogenicity
Immunization protocol:
Use at least 3-4 animals per antigen
Follow prime-boost schedule over 8-12 weeks
Include appropriate adjuvants (complete/incomplete Freund's)
Validation experiments:
Western blot against recombinant protein and Y. pestis lysates
Immunoprecipitation followed by mass spectrometry
Immunofluorescence microscopy to confirm membrane localization
Negative controls with pre-immune serum and YPDSF_0796-knockout strains
For membrane proteins like YPDSF_0796, antibodies directed against extracellular loops typically provide better results in applications requiring native protein recognition, while antibodies against intracellular domains perform better in denatured applications like Western blotting.
Investigation of YPDSF_0796 protein-protein interactions requires specialized approaches due to its membrane localization:
Membrane yeast two-hybrid (MYTH) system:
Split-ubiquitin-based approach specific for membrane proteins
Enables screening of protein libraries against YPDSF_0796 as bait
Requires verification using secondary methods
Co-immunoprecipitation with crosslinking:
Apply membrane-permeable crosslinkers (DSP, formaldehyde)
Solubilize membranes with mild detergents
Immunoprecipitate with anti-YPDSF_0796 antibodies
Identify interacting partners by mass spectrometry
Proximity labeling methods:
Express YPDSF_0796 fused to BioID or APEX2
Allow in vivo biotinylation of proximal proteins
Identify biotinylated proteins by streptavidin pulldown and mass spectrometry
Surface plasmon resonance (SPR):
Reconstitute purified YPDSF_0796 in lipid nanodiscs
Immobilize on sensor chip and test candidate interacting proteins
Determine binding kinetics and affinity constants
Each method has advantages and limitations. A multi-method approach provides the most robust evidence for genuine interactions, particularly for membrane proteins where false positives and negatives are common .
While the precise function of YPDSF_0796 remains to be fully characterized, several lines of evidence suggest potential roles in Y. pestis pathogenesis:
Expression pattern analysis: Transcriptomic studies have shown YPDSF_0796 expression is upregulated during temperature shift from environmental (26°C) to mammalian host temperatures (37°C), suggesting involvement in host adaptation.
Structural homology: Sequence analysis indicates distant homology with bacterial transporters, suggesting possible roles in nutrient acquisition or toxic compound efflux during infection.
Genetic studies: Preliminary knockout studies in related Yersinia species have shown altered membrane permeability and reduced survival under stress conditions, although direct evidence in Y. pestis is limited.
Compared to well-characterized virulence factors like the F1 antigen, YPDSF_0796 likely plays a more subtle role in pathogenesis, potentially contributing to bacterial fitness during infection rather than directly mediating host-pathogen interactions .
Structural and functional comparisons reveal both unique and shared features between YPDSF_0796 and other Y. pestis membrane proteins:
| Membrane Protein | Primary Function | Structural Features | Expression Pattern | Contribution to Virulence |
|---|---|---|---|---|
| YPDSF_0796 (UPF0283) | Unknown (possible transporter) | Multi-pass membrane protein, 353 aa | Temperature-regulated | Under investigation |
| F1 antigen (Caf1) | Antiphagocytic capsular protein | Fiber-forming protein, forms multimers | Temperature-induced | Major virulence factor |
| YopB/YopD | Type III secretion system components | Single-pass membrane proteins | Contact-dependent | Essential for virulence |
| Pla | Plasminogen activator | Beta-barrel outer membrane protein | Constitutive | Major virulence factor |
While the F1 antigen forms an extracellular capsule protecting bacteria from phagocytosis, YPDSF_0796 appears to be an integral membrane protein with potentially distinct functional roles. Unlike the well-characterized virulence factors (Yops, Pla), YPDSF_0796 lacks obvious secretion or processing signals, suggesting it functions within the bacterial membrane rather than directly interacting with host factors .
A comprehensive functional characterization strategy for YPDSF_0796 should include:
Genetic manipulation:
Generate clean deletion mutants in Y. pestis using allelic exchange
Create complemented strains expressing wild-type or tagged YPDSF_0796
Develop conditional expression systems for essential gene studies
Phenotypic characterization:
Membrane integrity assays (NPN uptake, propidium iodide staining)
Growth kinetics under various stress conditions (pH, temperature, oxidative stress)
Antibiotic susceptibility profiling
Metabolite transport assays if transporter function is suspected
In vivo significance:
Mouse infection models comparing wild-type and YPDSF_0796 mutants
Competition assays to assess fitness contributions
Tissue distribution and bacterial load measurements
Immune response characterization
Structural biology approaches:
Cryo-EM or X-ray crystallography of purified protein
Molecular dynamics simulations to predict functional sites
Site-directed mutagenesis to validate functional predictions
This multi-disciplinary approach would provide comprehensive insights into YPDSF_0796 function, from molecular mechanisms to in vivo significance .
Reconstituting membrane proteins like YPDSF_0796 into liposomes presents several technical challenges:
Challenges:
Maintaining protein stability during detergent removal
Achieving correct orientation in the membrane
Preserving native conformation and function
Ensuring homogeneous incorporation
Optimized reconstitution protocol:
Prepare liposomes from E. coli polar lipids or synthetic mixtures (POPC:POPE:POPG at 7:2:1 ratio)
Solubilize lipids with mild detergents (DDM or Triton X-100)
Mix purified YPDSF_0796 at protein-to-lipid ratios of 1:50 to 1:200 (w/w)
Remove detergent gradually using Bio-Beads SM-2 or dialysis
Confirm reconstitution by freeze-fracture electron microscopy or sucrose density gradient centrifugation
Functional validation:
Conduct proteoliposome permeability assays using fluorescent dyes
Measure ion or substrate transport using radioactive tracers
Assess lipid bilayer integrity using calcein leakage assays
Alternative approaches include nanodiscs and amphipol systems, which maintain membrane proteins in solution without conventional detergents and may better preserve native function for certain applications.
Although direct evidence for YPDSF_0796 interaction with host immune receptors is limited, several hypothetical mechanisms can be proposed based on knowledge of other Y. pestis membrane proteins:
Potential interaction mechanisms:
Recognition by pattern recognition receptors (PRRs) such as Toll-like receptors (particularly TLR2/TLR4)
Exposure of protein epitopes during bacterial lysis that may trigger adaptive immune responses
Possible immunomodulatory functions that influence host cytokine production
Experimental approaches to investigate:
Reporter cell lines expressing individual TLRs or NLRs exposed to purified YPDSF_0796
Co-immunoprecipitation studies with solubilized host cell receptors
Cytokine profiling of macrophages exposed to wild-type versus YPDSF_0796-deficient Y. pestis
T-cell activation assays using antigen-presenting cells loaded with YPDSF_0796 peptides
Related studies with other Y. pestis proteins have shown that bacterial membrane proteins can interact with host SIGNR1 (CD209b) to promote host dissemination, suggesting potential analogous roles for other membrane components including YPDSF_0796 .
Determination of YPDSF_0796's three-dimensional structure requires specialized approaches for membrane proteins:
X-ray crystallography:
Challenges: Obtaining well-diffracting crystals of membrane proteins
Solutions: Lipidic cubic phase (LCP) crystallization, fusion with crystallization chaperones
Expected resolution: 2.0-3.5 Å if successful
Cryo-electron microscopy (cryo-EM):
Advantages: No crystallization required, can capture different conformational states
Challenges: Size limitations (YPDSF_0796 at ~40 kDa is relatively small)
Strategy: Antibody fragment complexes or oligomerization to increase size
Nuclear magnetic resonance (NMR) spectroscopy:
Applicable for: Solution NMR for detergent-solubilized protein or solid-state NMR for reconstituted samples
Requirements: Isotope labeling (15N, 13C, 2H) during recombinant expression
Limitations: Size constraints and spectral complexity
Integrative structural biology:
Combine: Low-resolution electron microscopy with molecular modeling
Validate: Cross-linking mass spectrometry to identify distance constraints
Refine: Molecular dynamics simulations in explicit membrane environments
Success in structural determination would provide valuable insights into YPDSF_0796 function, potential ligand binding sites, and rational design of inhibitors that might interfere with Y. pestis membrane functions.
Researchers frequently encounter several challenges when working with recombinant YPDSF_0796:
Low expression yields:
Problem: Membrane proteins often express poorly in standard systems
Solution: Use specialized E. coli strains (C41/C43), lower induction temperature (16-18°C), and consider fusion tags (MBP, SUMO) to enhance solubility
Protein aggregation:
Problem: Tendency to aggregate during purification
Solution: Maintain detergent above critical micelle concentration throughout purification, include glycerol (10%) in buffers, and consider screening multiple detergents (DDM, LMNG, CHAPS)
Loss of activity during storage:
Problem: Functional deterioration even when properly stored
Solution: Add stabilizing agents (glycerol, trehalose), store at -80°C in single-use aliquots, and consider adding reducing agents if cysteine residues are present
Inconsistent antibody recognition:
Problem: Variable results in immunological detection
Solution: Use multiple antibodies targeting different epitopes, optimize denaturing conditions for Western blotting, and include positive controls
Non-specific binding in interaction studies:
Problem: High background in pull-down assays
Solution: Include higher salt (300-500 mM NaCl) and detergent (0.1% Triton X-100) in wash buffers, and use recombinant tagged proteins as negative controls
Incorporating these solutions into experimental workflows significantly improves success rates when working with this challenging membrane protein .
Interpreting oligomerization states of YPDSF_0796 requires careful analysis:
Distinguishing physiological from artifactual oligomerization:
Physiological oligomers: Stable across different detergents and concentrations
Artifactual aggregation: Concentration-dependent, varies with detergent type
Validation approach: Crosslinking studies in native membranes before extraction
Analytical techniques for oligomerization assessment:
Size exclusion chromatography: Provides apparent molecular weight including detergent micelle
Blue native PAGE: Separates complexes while maintaining native interactions
Analytical ultracentrifugation: Provides precise stoichiometry information
Multi-angle light scattering (MALS): Determines absolute molecular weight independent of shape
Interpreting size exclusion chromatography data:
| Elution Volume | Apparent MW | Likely Species | Functional Relevance |
|---|---|---|---|
| 8-10 mL* | >670 kDa | Higher-order aggregates | Typically non-functional |
| 12-14 mL* | 150-300 kDa | Oligomers with detergent micelle | Potential functional form |
| 16-18 mL* | 40-80 kDa | Monomer with detergent micelle | May represent functional unit |
*Values based on typical Superose 6 10/300 column calibrated with standard proteins
Similar to findings with the F1 antigen from Y. pestis, which shows functional differences between monomeric and multimeric forms, the oligomeric state of YPDSF_0796 may significantly impact its functional properties .
When conducting mutagenesis studies to elucidate structure-function relationships in YPDSF_0796, appropriate statistical approaches are essential:
Experimental design considerations:
Include multiple technical and biological replicates (minimum n=3)
Incorporate appropriate positive and negative controls
Use systematic alanine scanning or targeted mutations based on conservation analysis
Consider combinatorial mutations to identify synergistic effects
Statistical methods for phenotypic analysis:
For continuous variables (e.g., transport rates, binding affinities):
One-way ANOVA with post-hoc tests (Tukey's or Dunnett's) for multiple comparisons
Linear regression for correlation between multiple parameters
For categorical outcomes (e.g., growth/no growth):
Chi-square or Fisher's exact tests
Logistic regression for multivariate analysis
Advanced analytical approaches:
Principal component analysis (PCA) to identify patterns across multiple mutants
Hierarchical clustering to group functionally similar mutations
Structure-based energy calculations to correlate experimental results with computational predictions
Data visualization recommendations:
Heat maps for comprehensive mutation datasets
Scatter plots with regression lines for structure-function correlations
Three-dimensional structural models with color-coded mutational effects
These approaches enable robust statistical evaluation of mutational effects, helping to distinguish significant functional changes from experimental variability and providing insights into critical structural elements of YPDSF_0796.