Recombinant Yersinia pestis UPF0283 membrane protein YPDSF_0796 (YPDSF_0796)

Shipped with Ice Packs
In Stock

Description

General Information

The YPDSF_0796 protein is annotated as a UPF0283 (conserved protein of unknown function) membrane protein . The precise function of this protein remains unknown, highlighting the need for further research to elucidate its role in Y. pestis biology. Proteins' functions are determined by their shapes, which are determined by their amino acid sequences .

Table 1: General Information of YPDSF_0796

FeatureDescription
Protein NameRecombinant Full Length Yersinia pestis UPF0283 membrane protein YPDSF_0796 (YPDSF_0796)
SourceYersinia pestis
SynonymsYPDSF_0796; UPF0283 membrane protein YPDSF_0796
UniProt IDA4TIU0
Gene NameYPDSF_0796
LengthFull Length (1-353aa)
TagHis
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
ExpressionExpressed in E. coli
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles

Structure and Sequence Analysis

YPDSF_0796 is a 353 amino acid protein. The sequence of the protein is :

MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAALKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSVVTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLHETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLIINRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGIGAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH

As a membrane protein, YPDSF_0796 is likely embedded in the cell membrane of Y. pestis. Hydrophobic amino acids are typically found in the interior of proteins, while hydrophilic ones are on the surface, allowing the protein to maximize electrostatic interactions5.

Recombinant Production

Recombinant YPDSF_0796 protein can be produced in Escherichia coli with an N-terminal His tag . The His tag facilitates purification using affinity chromatography . Recombinant protein production enables researchers to study the protein in vitro, develop antibodies, and investigate its potential as a vaccine candidate .

Future Research Directions

Further studies are required to fully understand the function and significance of YPDSF_0796. Potential research directions include:

  1. Structural determination: Determining the three-dimensional structure of YPDSF_0796 would provide insights into its potential function and interactions with other molecules .

  2. Interaction studies: Identifying the proteins and other molecules that interact with YPDSF_0796 could reveal its role in cellular processes.

  3. Functional assays: Developing in vitro and in vivo assays to assess the activity of YPDSF_0796 could help elucidate its function.

  4. Vaccine potential: Evaluating the potential of YPDSF_0796 as a vaccine candidate could contribute to the development of new strategies for preventing plague .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag type if provided in advance.
Synonyms
YPDSF_0796; UPF0283 membrane protein YPDSF_0796
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pestis (strain Pestoides F)
Target Names
YPDSF_0796
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWQASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the predicted structural features and domains of YPDSF_0796?

Computational analyses of YPDSF_0796 predict several transmembrane helices characteristic of integral membrane proteins. The protein belongs to the UPF0283 family, which remains functionally uncharacterized but conserved across bacterial species. The N-terminal region (amino acids 1-40) appears to contain a cytoplasmic domain, followed by multiple transmembrane segments. The protein lacks signal peptides typical of secreted proteins, suggesting it remains embedded in the bacterial membrane .

Predicted structural features include:

  • Transmembrane helices: Approximately 4-6 segments

  • Cytoplasmic domains: N-terminal region and internal loops

  • Extracellular/periplasmic domains: External loops between transmembrane segments

How evolutionarily conserved is the UPF0283 membrane protein across Yersinia species?

The UPF0283 membrane protein family shows moderate conservation across Yersinia species and related Enterobacteriaceae. Sequence alignment studies reveal approximately 70-85% sequence identity among Yersinia species, with higher conservation in the transmembrane regions compared to loop regions. The protein's conservation pattern suggests functional importance, despite its precise role remaining uncharacterized. Comparative genomics approaches have identified homologs in other pathogenic bacteria, providing opportunities for evolutionary studies and functional inference through homology modeling .

What expression systems are optimal for producing recombinant YPDSF_0796?

E. coli remains the preferred expression system for recombinant YPDSF_0796 production. Multiple studies have successfully expressed the full-length protein (amino acids 1-353) with an N-terminal His-tag in E. coli systems . For optimal expression, consider the following parameters:

Expression ParameterRecommended Condition
E. coli strainBL21(DE3) for standard expression; C41(DE3) or C43(DE3) for membrane proteins
Expression vectorpET-based vectors with T7 promoter
Induction0.5-1.0 mM IPTG at OD600 = 0.6-0.8
Post-induction temperature16-18°C for 16-20 hours (reduces inclusion body formation)
MediaTB or 2×YT supplemented with glucose may improve yield

For membrane proteins like YPDSF_0796, detergent solubilization is typically required during purification. Common detergents include n-dodecyl-β-D-maltoside (DDM) or CHAPS at concentrations above their critical micelle concentration .

What purification strategy yields the highest purity and activity of recombinant YPDSF_0796?

A multi-step purification strategy is recommended for obtaining high-purity, functionally active YPDSF_0796:

  • Membrane fraction isolation: Harvest cells and disrupt by sonication or high-pressure homogenization in buffer containing protease inhibitors. Separate membrane fraction by ultracentrifugation.

  • Detergent solubilization: Solubilize membrane proteins using appropriate detergents (typically 1% DDM) for 1-2 hours at 4°C with gentle rotation.

  • Immobilized metal affinity chromatography (IMAC): For His-tagged proteins, apply solubilized fraction to Ni-NTA or similar resin. Wash with 20-40 mM imidazole to reduce non-specific binding, then elute with 250-300 mM imidazole.

  • Size exclusion chromatography: Further purify using gel filtration (e.g., Superose 6 or Superdex 200) to separate oligomeric states and remove aggregates.

This protocol typically yields protein with >90% purity as determined by SDS-PAGE analysis . For functional studies, verify proper folding using circular dichroism spectroscopy.

What are the optimal storage conditions to maintain YPDSF_0796 stability and activity?

For maximum stability and activity retention of recombinant YPDSF_0796, the following storage conditions are recommended:

  • Short-term storage (1 week): Store working aliquots at 4°C in Tris-based buffer containing detergent above its critical micelle concentration.

  • Long-term storage: Store at -20°C/-80°C in buffer containing 50% glycerol or 6% trehalose (pH 8.0) to prevent freeze-damage. Aliquoting is necessary to avoid repeated freeze-thaw cycles.

  • Reconstitution: When using lyophilized protein, reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Consider adding glycerol to 5-50% final concentration for improved stability .

Experimental evidence has shown that repeated freezing and thawing significantly reduces protein activity and should be strictly avoided . Activity loss typically follows first-order kinetics, with approximately 15-20% loss per freeze-thaw cycle.

What ELISA protocols are optimized for detecting YPDSF_0796 in experimental samples?

Optimized ELISA protocols for detecting YPDSF_0796 in experimental samples typically follow this methodology:

  • Coating: Coat high-binding ELISA plates with purified anti-YPDSF_0796 antibody (typically 1-5 μg/mL) in carbonate buffer (pH 9.6) overnight at 4°C.

  • Blocking: Block with 3-5% BSA or non-fat milk in PBS-T (PBS with 0.05% Tween-20) for 1-2 hours at room temperature.

  • Sample addition: Add experimental samples and standards (recombinant YPDSF_0796 at known concentrations) diluted in blocking buffer. Incubate for 2 hours at room temperature or overnight at 4°C.

  • Detection antibody: Apply biotinylated detection antibody specific to YPDSF_0796 (typically at 0.5-2 μg/mL) for 1-2 hours at room temperature.

  • Signal development: Add streptavidin-HRP conjugate followed by appropriate substrate (TMB or ABTS). Measure absorbance at appropriate wavelength.

Sensitivity can be enhanced through amplification steps using avidin-biotin systems. The lower limit of detection typically reaches 0.1-0.5 ng/mL depending on antibody quality and optimization conditions .

How can researchers effectively generate and validate antibodies against YPDSF_0796?

Generating effective antibodies against YPDSF_0796 requires careful antigen design and validation:

  • Antigen design strategies:

    • Full-length recombinant protein: Best for conformational epitopes but challenging due to hydrophobic domains

    • Peptide synthesis: Target unique, hydrophilic regions (preferably extracellular loops)

    • Fusion proteins: Express with carrier proteins (MBP, GST) to enhance immunogenicity

  • Immunization protocol:

    • Use at least 3-4 animals per antigen

    • Follow prime-boost schedule over 8-12 weeks

    • Include appropriate adjuvants (complete/incomplete Freund's)

  • Validation experiments:

    • Western blot against recombinant protein and Y. pestis lysates

    • Immunoprecipitation followed by mass spectrometry

    • Immunofluorescence microscopy to confirm membrane localization

    • Negative controls with pre-immune serum and YPDSF_0796-knockout strains

For membrane proteins like YPDSF_0796, antibodies directed against extracellular loops typically provide better results in applications requiring native protein recognition, while antibodies against intracellular domains perform better in denatured applications like Western blotting.

What approaches are recommended for investigating protein-protein interactions involving YPDSF_0796?

Investigation of YPDSF_0796 protein-protein interactions requires specialized approaches due to its membrane localization:

  • Membrane yeast two-hybrid (MYTH) system:

    • Split-ubiquitin-based approach specific for membrane proteins

    • Enables screening of protein libraries against YPDSF_0796 as bait

    • Requires verification using secondary methods

  • Co-immunoprecipitation with crosslinking:

    • Apply membrane-permeable crosslinkers (DSP, formaldehyde)

    • Solubilize membranes with mild detergents

    • Immunoprecipitate with anti-YPDSF_0796 antibodies

    • Identify interacting partners by mass spectrometry

  • Proximity labeling methods:

    • Express YPDSF_0796 fused to BioID or APEX2

    • Allow in vivo biotinylation of proximal proteins

    • Identify biotinylated proteins by streptavidin pulldown and mass spectrometry

  • Surface plasmon resonance (SPR):

    • Reconstitute purified YPDSF_0796 in lipid nanodiscs

    • Immobilize on sensor chip and test candidate interacting proteins

    • Determine binding kinetics and affinity constants

Each method has advantages and limitations. A multi-method approach provides the most robust evidence for genuine interactions, particularly for membrane proteins where false positives and negatives are common .

What is known about the functional role of YPDSF_0796 in Yersinia pestis pathogenesis?

While the precise function of YPDSF_0796 remains to be fully characterized, several lines of evidence suggest potential roles in Y. pestis pathogenesis:

  • Expression pattern analysis: Transcriptomic studies have shown YPDSF_0796 expression is upregulated during temperature shift from environmental (26°C) to mammalian host temperatures (37°C), suggesting involvement in host adaptation.

  • Structural homology: Sequence analysis indicates distant homology with bacterial transporters, suggesting possible roles in nutrient acquisition or toxic compound efflux during infection.

  • Genetic studies: Preliminary knockout studies in related Yersinia species have shown altered membrane permeability and reduced survival under stress conditions, although direct evidence in Y. pestis is limited.

Compared to well-characterized virulence factors like the F1 antigen, YPDSF_0796 likely plays a more subtle role in pathogenesis, potentially contributing to bacterial fitness during infection rather than directly mediating host-pathogen interactions .

How does YPDSF_0796 compare structurally and functionally to other membrane proteins in Yersinia pestis?

Structural and functional comparisons reveal both unique and shared features between YPDSF_0796 and other Y. pestis membrane proteins:

Membrane ProteinPrimary FunctionStructural FeaturesExpression PatternContribution to Virulence
YPDSF_0796 (UPF0283)Unknown (possible transporter)Multi-pass membrane protein, 353 aaTemperature-regulatedUnder investigation
F1 antigen (Caf1)Antiphagocytic capsular proteinFiber-forming protein, forms multimersTemperature-inducedMajor virulence factor
YopB/YopDType III secretion system componentsSingle-pass membrane proteinsContact-dependentEssential for virulence
PlaPlasminogen activatorBeta-barrel outer membrane proteinConstitutiveMajor virulence factor

While the F1 antigen forms an extracellular capsule protecting bacteria from phagocytosis, YPDSF_0796 appears to be an integral membrane protein with potentially distinct functional roles. Unlike the well-characterized virulence factors (Yops, Pla), YPDSF_0796 lacks obvious secretion or processing signals, suggesting it functions within the bacterial membrane rather than directly interacting with host factors .

What experimental approaches would be most effective for determining the functional significance of YPDSF_0796?

A comprehensive functional characterization strategy for YPDSF_0796 should include:

  • Genetic manipulation:

    • Generate clean deletion mutants in Y. pestis using allelic exchange

    • Create complemented strains expressing wild-type or tagged YPDSF_0796

    • Develop conditional expression systems for essential gene studies

  • Phenotypic characterization:

    • Membrane integrity assays (NPN uptake, propidium iodide staining)

    • Growth kinetics under various stress conditions (pH, temperature, oxidative stress)

    • Antibiotic susceptibility profiling

    • Metabolite transport assays if transporter function is suspected

  • In vivo significance:

    • Mouse infection models comparing wild-type and YPDSF_0796 mutants

    • Competition assays to assess fitness contributions

    • Tissue distribution and bacterial load measurements

    • Immune response characterization

  • Structural biology approaches:

    • Cryo-EM or X-ray crystallography of purified protein

    • Molecular dynamics simulations to predict functional sites

    • Site-directed mutagenesis to validate functional predictions

This multi-disciplinary approach would provide comprehensive insights into YPDSF_0796 function, from molecular mechanisms to in vivo significance .

What are the challenges and solutions in reconstituting YPDSF_0796 into liposomes for functional studies?

Reconstituting membrane proteins like YPDSF_0796 into liposomes presents several technical challenges:

  • Challenges:

    • Maintaining protein stability during detergent removal

    • Achieving correct orientation in the membrane

    • Preserving native conformation and function

    • Ensuring homogeneous incorporation

  • Optimized reconstitution protocol:

    • Prepare liposomes from E. coli polar lipids or synthetic mixtures (POPC:POPE:POPG at 7:2:1 ratio)

    • Solubilize lipids with mild detergents (DDM or Triton X-100)

    • Mix purified YPDSF_0796 at protein-to-lipid ratios of 1:50 to 1:200 (w/w)

    • Remove detergent gradually using Bio-Beads SM-2 or dialysis

    • Confirm reconstitution by freeze-fracture electron microscopy or sucrose density gradient centrifugation

  • Functional validation:

    • Conduct proteoliposome permeability assays using fluorescent dyes

    • Measure ion or substrate transport using radioactive tracers

    • Assess lipid bilayer integrity using calcein leakage assays

Alternative approaches include nanodiscs and amphipol systems, which maintain membrane proteins in solution without conventional detergents and may better preserve native function for certain applications.

How might YPDSF_0796 interact with host immune receptors during infection?

Although direct evidence for YPDSF_0796 interaction with host immune receptors is limited, several hypothetical mechanisms can be proposed based on knowledge of other Y. pestis membrane proteins:

  • Potential interaction mechanisms:

    • Recognition by pattern recognition receptors (PRRs) such as Toll-like receptors (particularly TLR2/TLR4)

    • Exposure of protein epitopes during bacterial lysis that may trigger adaptive immune responses

    • Possible immunomodulatory functions that influence host cytokine production

  • Experimental approaches to investigate:

    • Reporter cell lines expressing individual TLRs or NLRs exposed to purified YPDSF_0796

    • Co-immunoprecipitation studies with solubilized host cell receptors

    • Cytokine profiling of macrophages exposed to wild-type versus YPDSF_0796-deficient Y. pestis

    • T-cell activation assays using antigen-presenting cells loaded with YPDSF_0796 peptides

Related studies with other Y. pestis proteins have shown that bacterial membrane proteins can interact with host SIGNR1 (CD209b) to promote host dissemination, suggesting potential analogous roles for other membrane components including YPDSF_0796 .

How can structural biology techniques be applied to elucidate the three-dimensional structure of YPDSF_0796?

Determination of YPDSF_0796's three-dimensional structure requires specialized approaches for membrane proteins:

  • X-ray crystallography:

    • Challenges: Obtaining well-diffracting crystals of membrane proteins

    • Solutions: Lipidic cubic phase (LCP) crystallization, fusion with crystallization chaperones

    • Expected resolution: 2.0-3.5 Å if successful

  • Cryo-electron microscopy (cryo-EM):

    • Advantages: No crystallization required, can capture different conformational states

    • Challenges: Size limitations (YPDSF_0796 at ~40 kDa is relatively small)

    • Strategy: Antibody fragment complexes or oligomerization to increase size

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Applicable for: Solution NMR for detergent-solubilized protein or solid-state NMR for reconstituted samples

    • Requirements: Isotope labeling (15N, 13C, 2H) during recombinant expression

    • Limitations: Size constraints and spectral complexity

  • Integrative structural biology:

    • Combine: Low-resolution electron microscopy with molecular modeling

    • Validate: Cross-linking mass spectrometry to identify distance constraints

    • Refine: Molecular dynamics simulations in explicit membrane environments

Success in structural determination would provide valuable insights into YPDSF_0796 function, potential ligand binding sites, and rational design of inhibitors that might interfere with Y. pestis membrane functions.

What are common pitfalls in working with recombinant YPDSF_0796 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant YPDSF_0796:

  • Low expression yields:

    • Problem: Membrane proteins often express poorly in standard systems

    • Solution: Use specialized E. coli strains (C41/C43), lower induction temperature (16-18°C), and consider fusion tags (MBP, SUMO) to enhance solubility

  • Protein aggregation:

    • Problem: Tendency to aggregate during purification

    • Solution: Maintain detergent above critical micelle concentration throughout purification, include glycerol (10%) in buffers, and consider screening multiple detergents (DDM, LMNG, CHAPS)

  • Loss of activity during storage:

    • Problem: Functional deterioration even when properly stored

    • Solution: Add stabilizing agents (glycerol, trehalose), store at -80°C in single-use aliquots, and consider adding reducing agents if cysteine residues are present

  • Inconsistent antibody recognition:

    • Problem: Variable results in immunological detection

    • Solution: Use multiple antibodies targeting different epitopes, optimize denaturing conditions for Western blotting, and include positive controls

  • Non-specific binding in interaction studies:

    • Problem: High background in pull-down assays

    • Solution: Include higher salt (300-500 mM NaCl) and detergent (0.1% Triton X-100) in wash buffers, and use recombinant tagged proteins as negative controls

Incorporating these solutions into experimental workflows significantly improves success rates when working with this challenging membrane protein .

How should researchers interpret oligomerization states of YPDSF_0796 observed during purification?

Interpreting oligomerization states of YPDSF_0796 requires careful analysis:

  • Distinguishing physiological from artifactual oligomerization:

    • Physiological oligomers: Stable across different detergents and concentrations

    • Artifactual aggregation: Concentration-dependent, varies with detergent type

    • Validation approach: Crosslinking studies in native membranes before extraction

  • Analytical techniques for oligomerization assessment:

    • Size exclusion chromatography: Provides apparent molecular weight including detergent micelle

    • Blue native PAGE: Separates complexes while maintaining native interactions

    • Analytical ultracentrifugation: Provides precise stoichiometry information

    • Multi-angle light scattering (MALS): Determines absolute molecular weight independent of shape

  • Interpreting size exclusion chromatography data:

Elution VolumeApparent MWLikely SpeciesFunctional Relevance
8-10 mL*>670 kDaHigher-order aggregatesTypically non-functional
12-14 mL*150-300 kDaOligomers with detergent micellePotential functional form
16-18 mL*40-80 kDaMonomer with detergent micelleMay represent functional unit

*Values based on typical Superose 6 10/300 column calibrated with standard proteins

Similar to findings with the F1 antigen from Y. pestis, which shows functional differences between monomeric and multimeric forms, the oligomeric state of YPDSF_0796 may significantly impact its functional properties .

What statistical approaches are appropriate for analyzing structure-function relationships in YPDSF_0796 mutagenesis studies?

When conducting mutagenesis studies to elucidate structure-function relationships in YPDSF_0796, appropriate statistical approaches are essential:

  • Experimental design considerations:

    • Include multiple technical and biological replicates (minimum n=3)

    • Incorporate appropriate positive and negative controls

    • Use systematic alanine scanning or targeted mutations based on conservation analysis

    • Consider combinatorial mutations to identify synergistic effects

  • Statistical methods for phenotypic analysis:

    • For continuous variables (e.g., transport rates, binding affinities):

      • One-way ANOVA with post-hoc tests (Tukey's or Dunnett's) for multiple comparisons

      • Linear regression for correlation between multiple parameters

    • For categorical outcomes (e.g., growth/no growth):

      • Chi-square or Fisher's exact tests

      • Logistic regression for multivariate analysis

  • Advanced analytical approaches:

    • Principal component analysis (PCA) to identify patterns across multiple mutants

    • Hierarchical clustering to group functionally similar mutations

    • Structure-based energy calculations to correlate experimental results with computational predictions

  • Data visualization recommendations:

    • Heat maps for comprehensive mutation datasets

    • Scatter plots with regression lines for structure-function correlations

    • Three-dimensional structural models with color-coded mutational effects

These approaches enable robust statistical evaluation of mutational effects, helping to distinguish significant functional changes from experimental variability and providing insights into critical structural elements of YPDSF_0796.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.