Recombinant Yersinia pseudotuberculosis serotype IB Arginine exporter protein ArgO (argO)

Shipped with Ice Packs
In Stock

Description

Introduction to ArgO

The ArgO protein, encoded by the argO gene in Yersinia pseudotuberculosis serotype IB, belongs to the LysE family of transmembrane transporters. It facilitates the export of arginine, a conditionally essential amino acid, and contributes to bacterial survival under stress conditions. Recombinant ArgO refers to the protein produced via genetic engineering for functional and structural studies .

Genetic and Functional Characteristics

  • Gene Location: The argO gene is part of the chromosomal genome, distinct from plasmid-encoded virulence factors in Y. pseudotuberculosis.

  • Protein Family: LysE family, known for small solute transport, including amino acids and ions .

  • Substrate Specificity: Primarily exports L-arginine, with potential roles in maintaining intracellular amino acid homeostasis .

Role in Antibiotic Resistance

ArgO is implicated in modulating bacterial susceptibility to antibiotics through indirect mechanisms. While not a primary multidrug efflux pump, its activity influences cellular stress responses.

Table 1: Antibiotic Susceptibility Associated with argO

Protein FamilyGeneFunctionSubstratesAffected Antibiotics
LysEargOArginine exportL-arginineAMP, BS, GFF, INH, NAL, PHL, TMP

Key findings:

  • Strains lacking argO show altered susceptibility to antibiotics such as ampicillin (AMP), nalidixic acid (NAL), and trimethoprim (TMP) .

  • This suggests ArgO’s role in mitigating metabolic stress caused by antibiotic-induced damage .

Research Findings and Mechanisms

  • Metabolic Interplay: Arginine export via ArgO may counteract intracellular acidification or oxidative stress triggered by antibiotics like β-lactams .

  • Regulatory Context: Unlike primary resistance genes (e.g., RND-family pumps like AcrB), argO is not constitutively expressed but is upregulated under nutrient limitation or host-imposed stress .

  • Structural Insights: Homology modeling predicts ArgO’s structure includes six transmembrane helices, consistent with LysE family topology .

Implications and Future Directions

  • Therapeutic Targeting: ArgO’s role in stress adaptation makes it a potential target for adjuvants that disrupt bacterial metabolic resilience during antibiotic treatment.

  • Unanswered Questions:

    • How does arginine export mechanistically influence antibiotic tolerance?

    • Is argO expression regulated by virulence-associated pathways in Y. pseudotuberculosis?

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
argO; YPTS_3325; Arginine exporter protein ArgO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
argO
Target Protein Sequence
MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL
Uniprot No.

Target Background

Function
This protein plays a role in arginine export. It is crucial for regulating intracellular arginine levels and maintaining the appropriate balance between arginine and lysine.
Database Links
Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis and what diseases does it cause?

Yersinia pseudotuberculosis is a gram-negative zoonotic bacterial pathogen that causes acute gastroenteritis and mesenteric lymphadenitis, often accompanied by fever and abdominal pain . It belongs to the enteropathogenic Yersinia species and is distributed worldwide, though its epidemiology in the United States is not well characterized . Y. pseudotuberculosis was first reported in the United States in 1938 but has rarely been identified since then, with only 14 cases documented from 1938 through 1973 . Some strains of Y. pseudotuberculosis have been associated with Far East scarlet-like fever (FESLF), which presents with erythematous skin rash, desquamation, exanthema, hyperhemic tongue, and toxic shock syndrome .

What is the argO gene and what is its function in bacterial systems?

The argO gene (previously known as yggA) encodes an arginine exporter protein that facilitates the outward transport of arginine from bacterial cells . Research indicates that the argO gene shares similarity with the basic amino acid exporter LysE of Corynebacterium glutamicum . The physiological function of ArgO protein appears to be either preventing the accumulation of toxic levels of canavanine (a plant-derived antimetabolite) or arginine, or maintaining an appropriate balance between intracellular lysine and arginine concentrations . In regulatory terms, argO expression is controlled by the transcriptional regulator ArgP, which can both activate and repress gene expression depending on environmental conditions .

How does the O-antigen structure in Y. pseudotuberculosis serotype IB differ from other serotypes?

Y. pseudotuberculosis displays various O-antigen serotypes, including IA, IB, IIA, and IVB. The O-antigen is part of the lipopolysaccharide present in the outer membrane and shows high polymorphism among different serotypes . Serotype IB is significant as research suggests it may represent a hybrid structure derived from the gene clusters of serotypes IVB and other strains . The O-antigen gene clusters for Y. pseudotuberculosis contain genes for the biosynthesis of 6-deoxy-d-mannoheptose, with six specific genes identified for the biosynthetic pathway leading to GDP-6-deoxy-d-mannoheptose, the precursor of this sugar . This structural variation has implications for bacterial surface recognition, immune evasion, and potentially for the function of membrane-associated proteins like ArgO.

What are the recommended methods for cloning and expressing recombinant ArgO from Y. pseudotuberculosis serotype IB?

For cloning and expressing recombinant ArgO from Y. pseudotuberculosis serotype IB, researchers should consider the following methodological approach:

  • Gene Identification and Primer Design: Use genomic databases to identify the complete sequence of the argO gene in Y. pseudotuberculosis serotype IB. Design primers with appropriate restriction sites compatible with your expression vector.

  • PCR Amplification and Cloning: Extract genomic DNA from Y. pseudotuberculosis serotype IB cultures, perform PCR amplification of the argO gene, and clone the product into an appropriate expression vector (pET or pBAD systems are commonly used for membrane proteins).

  • Expression Optimization: Since ArgO is a membrane protein, expression conditions need careful optimization. Consider using E. coli strains specialized for membrane protein expression (C41(DE3) or C43(DE3)) and testing various induction parameters (temperature, inducer concentration, and duration).

  • Protein Purification Strategy: For membrane proteins like ArgO, solubilization with appropriate detergents (typically DDM, LDAO, or Triton X-100) followed by affinity chromatography using a fusion tag (His-tag or GST-tag) is recommended. Follow with size-exclusion chromatography for higher purity.

  • Verification Methods: Confirm protein identity using mass spectrometry and Western blotting with specific antibodies. Functional verification through arginine transport assays is essential to ensure the recombinant protein maintains its native activity.

This approach integrates standard molecular biology techniques with specialized protocols for membrane protein work, crucial for obtaining functional recombinant ArgO protein.

How can researchers assess the functional activity of recombinant ArgO protein?

Assessing the functional activity of recombinant ArgO protein requires specialized transport assays that can verify its arginine export capabilities:

  • Whole-Cell Transport Assays: Transform bacteria with the recombinant argO construct and measure the efflux of radiolabeled arginine (14C or 3H-labeled) from preloaded cells. Compare efflux rates between ArgO-expressing strains and control strains to quantify transport activity.

  • Reconstitution in Proteoliposomes: Purify the recombinant ArgO protein and reconstitute it into artificial liposomes. Measure arginine transport by monitoring the accumulation or release of radiolabeled arginine across the proteoliposome membrane under various conditions (pH gradients, membrane potential differences).

  • Canavanine Resistance Test: As the physiological function of ArgO may involve exporting the toxic arginine analog canavanine, measuring increased resistance to canavanine in ArgO-overexpressing strains provides indirect evidence of transport activity .

  • Competitive Inhibition Studies: Determine substrate specificity by measuring ArgO-mediated arginine transport in the presence of other basic amino acids or structural analogs.

  • Transport Kinetics Analysis: Determine Km and Vmax values for arginine transport to characterize the efficiency and capacity of the recombinant transporter. Compare these values with native ArgO to ensure proper folding and function of the recombinant protein.

These approaches collectively provide robust evidence for the functional integrity of recombinant ArgO and can help elucidate its transport mechanisms and substrate preferences.

What analytical techniques are most effective for studying the membrane topology of ArgO in Y. pseudotuberculosis?

Understanding the membrane topology of ArgO requires multiple complementary approaches:

  • Cysteine Scanning Mutagenesis: Systematically replace native residues with cysteine throughout the protein sequence. Use membrane-permeable and impermeable sulfhydryl reagents to determine which cysteines are accessible from which side of the membrane, revealing the topology.

  • Reporter Fusion Constructs: Generate fusion proteins with reporter tags (such as PhoA or GFP) at various positions. PhoA is active only when located in the periplasm, while GFP fluorescence is quenched in the periplasm, allowing determination of which protein segments reside in which cellular compartment.

  • Protease Protection Assays: Prepare membrane vesicles with defined orientation and treat with proteases. Fragments protected from proteolytic digestion indicate regions embedded within the membrane or located on the inaccessible side of the vesicle.

  • Epitope Mapping: Introduce epitope tags at various positions and use antibody accessibility (with or without membrane permeabilization) to determine which regions are exposed on which side of the membrane.

  • Computational Prediction and Validation: Use algorithms like TMHMM, MEMSAT, and PredictProtein to generate topology models, then experimentally validate key predictions using the techniques above.

This multi-technique approach provides a comprehensive view of ArgO's membrane topology, which is essential for understanding its transport mechanism and for structure-based drug design efforts targeting this protein.

How is argO expression regulated in Y. pseudotuberculosis compared to other bacteria?

The regulation of argO expression in Y. pseudotuberculosis integrates multiple signaling pathways:

  • ArgP Regulation: Similar to E. coli, the argO gene in Y. pseudotuberculosis is likely regulated by the ArgP transcriptional regulator . ArgP can function as both an activator and repressor depending on environmental conditions and the presence of cofactors like lysine and arginine.

  • Integration with Stress Response Systems: In Y. pseudotuberculosis, gene expression is significantly influenced by envelope stress response systems like the CpxA-CpxR two-component system . While direct regulation of argO by CpxR~P has not been specifically documented, the extensive regulatory network controlled by CpxR~P suggests potential interaction with arginine metabolism and transport pathways.

  • Nutritional Regulation: The RovA and RovM transcriptional regulators in Y. pseudotuberculosis respond to nutrient availability and stress conditions, with RovM specifically upregulated during nutrient limitation . Given that argO functions in amino acid homeostasis, its expression might be coordinated with these global nutritional response regulators.

  • Comparative Analysis: Unlike E. coli, where argO regulation has been well-characterized, the specific regulatory mechanisms in Y. pseudotuberculosis may incorporate additional pathogen-specific components reflecting its adaptation to host environments and pathogenic lifestyle.

The distinct regulatory pattern in Y. pseudotuberculosis likely reflects its evolution as a pathogen and the need to coordinate arginine export with virulence expression and stress responses in challenging host environments.

What is the relationship between the Cpx envelope stress system and ArgO function in Y. pseudotuberculosis?

The relationship between the Cpx envelope stress system and ArgO function represents a complex intersection of stress response and amino acid homeostasis:

  • Regulatory Network Overlap: The Cpx system in Y. pseudotuberculosis responds to cell envelope damage by activating CpxR through phosphorylation (CpxR~P) . While direct regulation of argO by CpxR~P has not been specifically documented, the Cpx system broadly influences membrane protein expression and function.

  • Stress Response Integration: Both systems serve protective functions - ArgO prevents toxic accumulation of arginine or maintains amino acid balance , while the Cpx system repairs and maintains envelope integrity . Their functions may be coordinated during host infection or environmental stress.

  • Virulence Regulation: CpxR~P significantly impacts Y. pseudotuberculosis virulence by repressing rovA expression and inducing rovM expression . As a membrane transporter potentially involved in adaptation to host environments, ArgO's function may be coordinated with these virulence regulators.

  • Membrane Integrity Considerations: Proper function of membrane transporters like ArgO depends on membrane integrity, which is maintained by the Cpx system. Conversely, arginine imbalance could potentially trigger envelope stress, activating the Cpx pathway.

This relationship illustrates how bacterial stress response systems and metabolic functions are integrated to support survival and pathogenesis in challenging environments. Future research investigating direct interactions between these systems could reveal important adaptation mechanisms in Y. pseudotuberculosis.

What protein-protein interactions are critical for ArgO function in the bacterial membrane?

The functionality of ArgO in the bacterial membrane depends on several key protein interactions:

  • Oligomerization States: Many membrane transporters function as oligomers. Based on structural studies of similar transporters, ArgO may form homodimers or higher-order oligomers that create the functional translocation pathway for arginine export.

  • Interactions with Lipid Rafts: ArgO function may depend on its localization within specific membrane microdomains with distinct lipid compositions. The O-antigen structure of Y. pseudotuberculosis serotype IB could influence these membrane dynamics and consequently affect ArgO activity .

  • Regulatory Protein Interactions: Beyond transcriptional regulation by ArgP , ArgO activity may be modulated through direct interactions with regulatory proteins that respond to intracellular arginine levels or environmental stress signals.

  • Envelope Maintenance Complexes: Given the importance of the cell envelope in Y. pseudotuberculosis pathogenesis, ArgO likely coordinates with membrane integrity maintenance proteins, potentially including those regulated by the Cpx system .

  • Metabolic Enzyme Coupling: ArgO may physically or functionally couple with enzymes involved in arginine biosynthesis or catabolism to efficiently coordinate arginine metabolism with export requirements.

These interactions collectively ensure proper ArgO localization, regulation, and function within the complex membrane environment of Y. pseudotuberculosis, supporting its role in maintaining amino acid homeostasis during infection and stress conditions.

How does ArgO contribute to Y. pseudotuberculosis virulence and pathogenicity?

The ArgO arginine exporter likely contributes to Y. pseudotuberculosis virulence through multiple mechanisms:

  • Amino Acid Homeostasis during Infection: By maintaining appropriate intracellular arginine levels, ArgO may help Y. pseudotuberculosis adapt to the nutritionally restrictive host environment. This homeostasis is particularly important as arginine is utilized for various virulence-associated processes.

  • Protection Against Host Defense Mechanisms: Host cells can produce antimicrobial compounds targeting bacterial arginine metabolism. ArgO-mediated efflux may protect against toxic accumulation of arginine or arginine analogs produced by host defense systems .

  • Modulation of Host Immune Responses: Arginine is a substrate for host enzymes like inducible nitric oxide synthase (iNOS) and arginase. By controlling extracellular arginine availability, Y. pseudotuberculosis may influence host nitric oxide production and other arginine-dependent immune functions.

  • Coordination with Virulence Regulators: The regulatory network controlling ArgO expression may intersect with key virulence regulators like RovA and RovM , allowing coordination of arginine export with virulence factor expression during different infection phases.

  • Survival in Different Host Niches: As Y. pseudotuberculosis transitions through different host environments during infection, ArgO-mediated arginine export may support adaptation to changing nutrient conditions and stresses.

What is the relationship between ArgO and the immune evasion strategies of Y. pseudotuberculosis?

The relationship between ArgO and Y. pseudotuberculosis immune evasion involves several sophisticated mechanisms:

  • Modulation of γδ T Cell Responses: Y. pseudotuberculosis targets adaptive γδ T cells to subvert immune function by inhibiting IFNγ production . While the primary mechanism involves Yop effectors, ArgO-mediated control of arginine availability may further influence T cell function, as arginine is critical for T cell proliferation and cytokine production.

  • Interference with Macrophage Antimicrobial Functions: Macrophages use arginine for both nitric oxide (NO) production (antimicrobial) and arginase activity (tissue repair). By controlling arginine export, Y. pseudotuberculosis may shift macrophage polarization away from antimicrobial functions.

  • Evasion of Nutritional Immunity: Host cells restrict nutrient availability as an antimicrobial strategy. ArgO may participate in counteracting this nutritional immunity by maintaining appropriate intracellular amino acid balances despite host-imposed restrictions.

  • Coordination with Type IVB Secretion System: Y. pseudotuberculosis possesses a type IVB secretion system that contributes to immunomodulatory capabilities . ArgO function may be coordinated with this secretion system to optimize bacterial survival during host immune responses.

  • Stress Response Integration: As part of the bacterial response to host-induced stresses, ArgO works alongside systems like the Cpx two-component system to maintain envelope integrity and cellular function despite antimicrobial host factors.

This multifaceted relationship highlights how metabolic functions like arginine transport integrate with virulence mechanisms to enhance Y. pseudotuberculosis survival during infection.

How do mutations in the argO gene affect Y. pseudotuberculosis survival within host cells?

Mutations in the argO gene can significantly impact Y. pseudotuberculosis survival within host cells through several mechanisms:

  • Altered Arginine Homeostasis: Loss-of-function mutations may lead to toxic intracellular accumulation of arginine or inability to maintain appropriate lysine-arginine balance, compromising bacterial viability during intracellular phases of infection .

  • Stress Response Deficiencies: ArgO mutations may impair bacterial adaptation to intracellular stresses, particularly those affecting the cell envelope. This vulnerability becomes especially pronounced when considered alongside the importance of envelope stress responses (like the Cpx system) in Y. pseudotuberculosis pathogenesis .

  • Metabolic Adaptation Impairment: Intracellular survival requires rapid adaptation to changing nutrient availability. ArgO mutants may show reduced fitness in host environments where controlled arginine export is necessary for metabolic adaptation.

  • Altered Virulence Expression: If argO regulation is integrated with virulence regulators like RovA and RovM , mutations could disrupt the coordinated expression of virulence factors needed for intracellular survival.

  • Increased Susceptibility to Host Defenses: ArgO mutants may show increased susceptibility to host antimicrobial mechanisms that target arginine metabolism or depend on arginine availability, such as nitric oxide production by macrophages.

Experimental studies tracking the intracellular survival rates of argO mutants compared to wild-type Y. pseudotuberculosis would provide valuable insights into the specific contributions of this transporter to bacterial fitness within different host cell types.

How conserved is the argO gene across different Yersinia species and strains?

The conservation pattern of the argO gene across Yersinia species reveals important evolutionary insights:

  • Within Y. pseudotuberculosis Strains: Different serotypes of Y. pseudotuberculosis show variation in their genome content, with some genes being strain-specific. Analysis of the population genetics indicates that Y. pseudotuberculosis is more heterogeneous compared to its evolutionary descendant Y. pestis . This heterogeneity may extend to the argO gene, with potential serotype-specific variations.

  • Between Yersinia Species: The evolutionary relationship between Y. pseudotuberculosis and Y. pestis is particularly informative. Y. pestis evolved from Y. pseudotuberculosis and shows a lack of genetic diversity compared to its ancestor . While core metabolic functions are generally conserved, Y. pestis has undergone gene loss and pseudogenization during its adaptation to a different lifecycle. Analysis of argO conservation can reveal whether this gene represents a core function or shows adaptation-related variations.

  • Functional Conservation vs. Sequence Variation: Even when conserved across species, the argO gene may show sequence variations that reflect adaptation to different ecological niches. These variations could affect substrate specificity, transport efficiency, or regulatory control.

  • Genomic Context Conservation: The genomic neighborhood of argO may vary between species and strains, potentially affecting its regulation and function. Analysis of synteny around the argO locus provides insights into its evolutionary history and potential horizontal transfer events.

This evolutionary perspective is crucial for understanding how arginine export functions have been maintained or adapted during Yersinia speciation and host adaptation processes.

What structural and functional differences exist between ArgO in Y. pseudotuberculosis and similar transporters in other bacterial species?

Comparing ArgO from Y. pseudotuberculosis with similar transporters reveals important structural and functional distinctions:

These comparative insights highlight how similar transporters have evolved distinct characteristics aligned with the physiological demands and pathogenic strategies of their respective bacterial species.

How has the argO gene evolved in Y. pseudotuberculosis compared to other arginine transport systems?

The evolutionary trajectory of the argO gene in Y. pseudotuberculosis reveals specialized adaptation:

  • Evolutionary Origin and Divergence: Phylogenetic analysis suggests argO evolved from ancestral amino acid transporters. The specific divergence pattern in Y. pseudotuberculosis reflects selection pressures related to its enteropathogenic lifestyle. Compared to Y. pestis, which evolved from Y. pseudotuberculosis but shows less genetic diversity , the argO gene in Y. pseudotuberculosis likely retains more ancestral functions.

  • Selective Pressures from Host Interactions: Unlike generic arginine transporters, the Y. pseudotuberculosis ArgO likely faced selection pressures from host-pathogen interactions. These pressures potentially shaped its specificity and regulatory mechanisms to support survival during infection stages where arginine availability is critical.

  • Relationship to Other Transport Systems: Y. pseudotuberculosis possesses multiple amino acid transport systems. The evolutionary relationship between ArgO and these systems illustrates how gene duplication and functional divergence have created specialized transporters for different physiological contexts.

  • Integration with Virulence Evolution: The evolution of argO likely paralleled the acquisition of virulence determinants. Key pathogenicity elements in Y. pseudotuberculosis include the Yersinia adhesion pathogenicity island (YAPI) and various secretion systems. The co-evolution of argO with these virulence factors reflects its integration into pathogenic processes.

  • Horizontal Gene Transfer Contributions: Y. pseudotuberculosis contains numerous horizontally acquired genetic elements . Analysis of whether argO shows evidence of horizontal acquisition or has evolved vertically within the Yersinia lineage provides insights into its evolutionary history.

This evolutionary perspective helps explain how ArgO has been fine-tuned to support the specific ecological and pathogenic niche occupied by Y. pseudotuberculosis.

What are the potential applications of recombinant ArgO in developing antimicrobial strategies against Y. pseudotuberculosis?

Recombinant ArgO offers several promising avenues for antimicrobial development:

  • Inhibitor Design and Screening: Purified recombinant ArgO provides a platform for high-throughput screening of small molecule inhibitors. Compounds that block arginine export could potentially compromise Y. pseudotuberculosis survival by disrupting amino acid homeostasis, particularly during infection when arginine management is critical.

  • Structural Vaccinology Approaches: Specific extracellular epitopes of ArgO could serve as components in subunit vaccine formulations. This approach targets critical membrane functions while avoiding the complications of using whole bacterial cells.

  • Diagnostic Applications: Recombinant ArgO could be used to develop specific antibodies for immunodiagnostic assays targeting Y. pseudotuberculosis. Such diagnostics would be particularly valuable given the challenges in identifying this organism in clinical settings .

  • Combination Therapy Enhancement: Inhibiting ArgO function could potentially sensitize Y. pseudotuberculosis to existing antibiotics by compromising membrane integrity or stress response capabilities, particularly given the connections between amino acid transport and envelope stress systems like Cpx .

  • Adjuvant for Immune Response Modulation: By manipulating arginine availability, ArgO-based approaches could potentially enhance host immune responses against Y. pseudotuberculosis, counteracting the pathogen's immunosuppressive strategies like those targeting γδ T cells .

These applications represent sophisticated approaches to leveraging our understanding of ArgO function for targeted intervention strategies against Y. pseudotuberculosis infections.

How can site-directed mutagenesis of ArgO provide insights into the mechanism of arginine export in Y. pseudotuberculosis?

Site-directed mutagenesis represents a powerful approach for dissecting ArgO function:

  • Identification of Critical Transport Residues: Systematic mutation of conserved residues within predicted transmembrane domains can identify amino acids essential for arginine recognition and translocation. Conservative substitutions (e.g., lysine for arginine) can distinguish between residues involved in substrate binding versus structural roles.

  • Regulatory Domain Mapping: Mutations in potential regulatory regions can reveal how ArgO activity is modulated in response to cellular conditions. Particular focus should be placed on cytoplasmic domains that might interact with regulatory proteins or sense metabolite levels.

  • Substrate Specificity Determinants: Comparing the effects of mutations on transport of arginine versus other basic amino acids or analogs like canavanine can map the structural determinants of substrate specificity . This information is valuable for understanding both the natural function and potential for engineered specificity.

  • Oligomerization Interface Analysis: If ArgO functions as an oligomer, mutations at predicted protein-protein interaction surfaces can disrupt assembly and reveal the importance of oligomerization for transport activity.

  • Integration with Structural Studies: Combining mutagenesis with techniques like cysteine accessibility methods or distance measurements can generate constraints for computational modeling of ArgO structure, even in the absence of crystal structures.

This systematic mutagenesis approach provides a detailed functional map of ArgO that enhances our understanding of both its specific role in Y. pseudotuberculosis and broader principles of membrane transport mechanisms.

What cutting-edge technologies are advancing our understanding of ArgO function in bacterial pathogenesis?

Several innovative technologies are transforming our understanding of ArgO's role in pathogenesis:

  • Cryo-Electron Microscopy (Cryo-EM): This technique now achieves near-atomic resolution of membrane proteins without crystallization, enabling visualization of ArgO structure in different conformational states during the transport cycle.

  • Single-Molecule Transport Assays: By reconstituting single ArgO molecules in lipid nanodiscs or bilayers, researchers can monitor individual transport events, revealing mechanistic details masked in bulk transport studies and identifying potential heterogeneity in transporter behavior.

  • CRISPR-Cas9 Genomic Editing in Y. pseudotuberculosis: Precise genomic modification allows creation of ArgO variants tagged with fluorescent reporters or containing specific mutations directly in the pathogen genome, preserving native regulation and stoichiometry.

  • Intracellular Arginine Biosensors: Genetically encoded fluorescent biosensors for arginine enable real-time monitoring of arginine dynamics in live bacteria during infection, directly linking ArgO activity to intracellular arginine management.

  • Dual RNA-Seq of Host-Pathogen Interactions: This approach simultaneously captures transcriptional responses in both Y. pseudotuberculosis and infected host cells, revealing how ArgO expression coordinates with host arginine metabolism and immune responses during infection.

  • AlphaFold2 and Machine Learning Approaches: Advanced computational methods now predict protein structures with remarkable accuracy, offering insights into ArgO structure and dynamics even without experimental structural data, particularly valuable for membrane proteins that resist traditional structural analysis.

These technologies collectively provide unprecedented insights into the molecular mechanisms and physiological roles of ArgO, connecting structural details to pathogenesis functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.