Recombinant Yersinia pseudotuberculosis serotype IB ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Introduction

Yersinia pseudotuberculosis is a gram-negative bacterium that causes Far East scarlet-like fever (FESLF) . Y. pseudotuberculosis inhibits the inflammatory circuit, but its effect on PGE2 production is unknown . One of the Yersinia effector proteins is responsible for the inhibition of PGE2 biosynthesis . The YopJ virulence factor, encoded by Y. pseudotuberculosis, inactivates host MAPK signaling pathways . ATP synthase subunit b (atpF) is a component of the ATP synthase complex, which is essential for energy production in cells. Recombinant ATP synthase subunit b (atpF) refers to the protein that has been produced using recombinant DNA technology.

Characteristics of Recombinant Yersinia pseudotuberculosis serotype IB ATP synthase subunit b (atpF)

CharacteristicsDescription
Source OrganismYersinia pseudotuberculosis serotype IB (strain PB1/+)
Protein NameATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6
Gene NameatpB
Ordered Locus NamesYPTS_4174
Amino Acid Length274
Molecular WeightThe tag type will be determined during production process
Purity>90% as determined by SDS-PAGE
Tag InformationThe tag type will be determined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Storage ConditionsStore at -20℃, for extended storage, conserve at -20℃ or -80℃
AA SequenceMSASGEISTPRDYIGHHLNHLQLDLRTFELVNPHSTGPATFWTLNIDSLFFSVVLGLAFL LVFRKVAASATSGVPGKLQTAVELIIGFVDNSVRDMYHGKSKVIAPLALTVFVWVLLMNM MDLLPIDLLPYIGEHVFGLPALRVVPTADVSITLSMALGVFILIIFYSIKMKGVGGFTKE LTMQPFNHPIFIPVNLILEGVSLLSKPLSLGLRLFGNMYAGELIFILIAGLLPWWSQWmL SVPWAIFHILIITLQAFIFMVLTIVYLSMASEEH
Expression Region1-274

Function and Significance

ATP synthase is a vital enzyme complex that produces ATP, the primary energy currency of cells. It is found in the membranes of bacteria, mitochondria, and chloroplasts. ATP synthase consists of two main components: F0 and F1. The F0 component is embedded in the membrane and functions as a proton channel, while the F1 component is located in the cytoplasm or matrix and contains the catalytic sites for ATP synthesis. The subunit b (atpF) is a part of the F0 complex and plays a crucial role in proton translocation .

Applications in Research

Recombinant Y. pseudotuberculosis serotype IB ATP synthase subunit b (atpF) can be used in various research applications, including:

  • ELISA assays: As a recombinant protein, it can be used as an antigen in ELISA assays to detect and quantify antibodies against Y. pseudotuberculosis .

  • Structural studies: The recombinant protein can be used for structural studies to understand the structure and function of the ATP synthase complex .

  • Drug discovery: ATP synthase is a potential drug target, and the recombinant subunit b can be used in drug screening assays .

  • Functional studies: Recombinant atpF can be used to study the role of subunit b in ATP synthase activity and proton translocation .

  • Virulence studies: YopJ-mediated inhibition of MAPK signal transduction serves as a mechanism targeting PGE2, an alternative means of inflammasome inhibition by Yersinia .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; YPTS_4176; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
atpF
Target Protein Sequence
MNLNATILGQAIAFVLFVIFCMKYVWPPIMAAIEKRQQEIADGLSSAERAKKDLDLAQAN ATDQLKKAKAEAQVIIEQASKRKAQILDEAKAEAEQERNKIVAQAQAEIDAERKRAREEL RKQVAMLAIAGAEKIIERSVDEAANSDIVDKLVAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F(1) domain and the membrane-bound proton channel F(0) domain, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What experimental conditions are optimal for studying Y. pseudotuberculosis type III secretion system (T3SS) in relation to ATP-dependent processes?

T3SS expression and function in Y. pseudotuberculosis is highly regulated by environmental conditions that impact ATP utilization. For optimal T3SS expression, culture bacteria at 37°C in calcium-depleted media, which triggers secretion of Yop proteins. During experimental procedures, maintain these conditions for 5 hours to achieve maximum protein secretion . To differentiate between protein synthesis and secretion, compare protein presence in both cell lysates and culture supernatants using Western blotting. To assess if your protein of interest interacts with T3SS components, create mutations in key T3SS genes (yopB, yopD) that form the translocation pore and analyze effects on your target protein's expression or localization .

How do temperature and calcium concentration affect Y. pseudotuberculosis protein expression patterns?

Temperature and calcium availability serve as critical environmental signals that regulate Y. pseudotuberculosis virulence factor expression:

TemperatureCa²⁺ StatusProtein Expression PatternResearch Applications
37°CCa²⁺-depletedEnhanced T3SS secretion, Yop proteins actively secretedStudy virulence mechanisms, protein-protein interactions
37°CCa²⁺-repleteT3SS proteins synthesized but not secretedExamine protein accumulation within bacterial cells
26°CEitherUpregulation of flagellar genes and invasin (invA), reduced T3SS expressionStudy environmental adaptation and persistence mechanisms

As evidenced in transcriptional studies, Y. pseudotuberculosis undergoes significant reprogramming between virulent (37°C) and persistent (26°C-like) modes . When designing experiments to study recombinant proteins, consider these expression patterns to interpret results in proper physiological context.

What genetic engineering strategies can be used to create recombinant Y. pseudotuberculosis strains for studying membrane proteins like ATP synthase components?

To create recombinant Y. pseudotuberculosis strains for membrane protein studies, implement a multi-step engineering approach:

  • Design specific mutations in target genes using site-directed mutagenesis

  • For attenuated vaccine strains, introduce multiple mutations like those demonstrated in strain χ10069 (ΔyopK ΔyopJ Δasd)

  • Use balanced-lethal host-vector systems with essential gene complementation (e.g., asd gene with Asd+ plasmids) for stable maintenance of expression vectors without antibiotic selection

  • For membrane proteins like ATP synthase components, include their native promoters and signal sequences to ensure proper localization

  • Validate protein expression using immunoblotting under different growth conditions

  • Confirm membrane localization using cellular fractionation techniques followed by Western blotting

This approach has been successfully used for the delivery of recombinant fusion proteins like YopE-LcrV in Y. pseudotuberculosis .

What methods are most effective for assessing the impact of Y. pseudotuberculosis effector proteins on host cell energy metabolism?

To investigate how Y. pseudotuberculosis effector proteins impact host cell energy metabolism:

  • Implement proteomics approaches comparing wild-type infection versus infection with strains harboring catalytically inactive effectors (e.g., YopJC172A)

  • Use pathway analysis software to identify differentially regulated metabolic networks—research has shown YopJ affects oxidative phosphorylation and mitochondrial function pathways

  • Measure cellular ATP levels using luminescence-based assays

  • Assess mitochondrial membrane potential using fluorescent probes

  • Quantify oxygen consumption rate and extracellular acidification rate using Seahorse technology

  • For specific effector proteins, create clean deletion mutants and catalytically inactive point mutants to distinguish between structural and enzymatic contributions

Proteomics studies have revealed that YopJ affects multiple metabolic pathways, including oxidative phosphorylation and mitochondrial dysfunction , suggesting effects on cellular energy production that may involve ATP synthase activity.

How does the SmpB-SsrA system influence the expression and activity of energy metabolism proteins in Y. pseudotuberculosis during infection?

The SmpB-SsrA system plays a critical role in Y. pseudotuberculosis pathogenesis by maintaining proper translational quality control. Research has demonstrated that mutations in smpB-ssrA genes render Y. pseudotuberculosis avirulent and unable to cause mortality in mice . This system's influence on energy metabolism proteins involves:

  • Transcriptional regulation: The SmpB-SsrA system affects expression of numerous genes, including those involved in energy production

  • Quality control of stalled ribosomes: This prevents accumulation of incomplete proteins that could interfere with energy metabolism complexes

  • Stress adaptation: During host infection, this system helps maintain translational fidelity under stress conditions

To investigate relationships between SmpB-SsrA and specific proteins like ATP synthase components:

  • Create smpB-ssrA mutants and compare expression levels of target proteins using qRT-PCR and Western blotting

  • Perform RNA-seq analysis comparing wild-type and mutant strains during infection

  • Use chromatin immunoprecipitation to identify potential regulatory interactions

  • Assess ATP production capacity in wild-type versus mutant strains

Research has shown that smpB-ssrA mutants exhibit "severe deficiencies in expression and secretion of Yersinia virulence effector proteins" , suggesting broad impacts on protein expression that likely extend to energy metabolism components.

How does Y. pseudotuberculosis reprogram its energy metabolism during the transition from acute infection to persistence?

Y. pseudotuberculosis undergoes dramatic transcriptional reprogramming during the transition from acute infection to persistence. RNA-seq analysis of bacteria isolated from infected tissues revealed:

  • Downregulation of T3SS virulence genes during persistent infection in the cecum

  • Shift toward expression patterns resembling in vitro growth at 26°C during persistence

  • Upregulation of genes associated with alternative energy utilization pathways

To study changes in specific components like ATP synthase during this transition:

  • Perform temporal RNA-seq analysis focusing on energy metabolism genes

  • Use reporter strains with fluorescent or luminescent proteins fused to promoters of interest

  • Implement metabolomics approaches to track changes in cellular energy carriers

  • Use selective inhibitors of energy metabolism to assess bacterial survival during different infection phases

This transcriptional reprogramming likely involves changes in energy metabolism to support long-term survival within host tissues. Interestingly, despite low bacterial numbers recovered from infected tissues (1×10^5 to 2×10^6 CFUs), relatively high amounts of bacterial RNA were detected, suggesting active transcription during persistence .

What roles do Y. pseudotuberculosis T3SS effectors play in modulating host immune responses, and how could this impact research on other bacterial components?

Y. pseudotuberculosis T3SS effectors actively modulate host immune responses through multiple mechanisms:

  • YopJ inhibits MAPK/ERK signaling pathways that regulate inflammatory responses

  • YopJ specifically downregulates prostaglandin E2 (PGE2) biosynthesis by inhibiting cyclooxygenase-2 (COX-2) expression

  • T3SS pore formation triggers NFκB- and type I IFN-regulated gene expression independent of TLR signaling

  • Caspase-1 activation by the T3SS is required for IL-1β secretion

When studying other bacterial components like ATP synthase, researchers must consider these immunomodulatory effects as they may indirectly impact results. For example, YopJ-mediated suppression of host metabolism could alter the environment in which membrane proteins function.

EffectorPrimary TargetImmune EffectExperimental Consideration
YopJMAPK/ERK pathwayInhibits inflammatory cytokines and PGE2Use YopJC172A mutant as control
YopTHost cytoskeletonAmplifies immune responseMay enhance detection of bacterial antigens
YopB/YopDCell membraneForms pores that trigger immune signalingRequired for T3SS functionality

To isolate effects of specific bacterial components from these immunomodulatory activities, researchers should use defined mutants lacking specific effectors or the entire T3SS.

How can recombinant Y. pseudotuberculosis strains be engineered as vaccine delivery platforms for heterologous antigens?

Recombinant attenuated Y. pseudotuberculosis strains have demonstrated potential as vaccine vectors through strategic genetic modifications:

  • Create attenuated background strains through multiple mutations affecting virulence (e.g., ΔyopK ΔyopJ Δasd)

  • Implement balanced-lethal systems (e.g., Δasd mutation complemented with Asd+ plasmid) for stable antigen expression without antibiotic selection

  • Express antigens as fusions with T3SS substrates (e.g., YopE amino acids 1-138) to facilitate delivery into host cells

  • Optimize antigen expression through appropriate promoter selection and codon optimization

  • Confirm immunogenicity through assessment of both mucosal and systemic immune responses

This approach has been demonstrated effective with the YopE-LcrV fusion protein, which provided 80% protection against Y. pestis challenge when delivered by an engineered Y. pseudotuberculosis strain . The protective efficacy suggests this platform could potentially be adapted for delivery of other bacterial antigens.

What emerging technologies could enhance studies of Y. pseudotuberculosis membrane proteins in different growth conditions?

Several cutting-edge technologies show promise for advancing studies of Y. pseudotuberculosis membrane proteins:

  • Cryo-electron microscopy (cryo-EM) for high-resolution structural analysis of membrane protein complexes in near-native states

  • Single-cell RNA-seq to characterize heterogeneity in bacterial populations during infection

  • CRISPR interference (CRISPRi) for tunable gene repression to study essential membrane proteins

  • Bio-orthogonal labeling approaches to track protein synthesis and turnover in vivo

  • Advanced protein interaction techniques like proximity labeling to identify interaction partners

  • Integrin-activating Invasin protein as a defined substrate for culturing epithelial cells in 2D format to study host-pathogen interactions

The recently discovered application of Invasin as an ECM-like ligand opens new possibilities for studying bacterial-host interactions in a controlled 2D environment that facilitates imaging, functional assays, and high-throughput screening .

How might ATP synthase components interact with virulence determinants in Y. pseudotuberculosis during different stages of pathogenesis?

While direct evidence for ATP synthase interactions with virulence factors is limited, several hypothetical mechanisms warrant investigation:

  • Energy coupling between ATP synthase and protein secretion systems, particularly during times of high secretory demand

  • Potential membrane domain co-localization between ATP synthase and the T3SS apparatus

  • Metabolic regulation linking energy status to virulence gene expression

  • Adaptation of energy production during different infection phases, particularly during the transition to persistence where Y. pseudotuberculosis undergoes significant transcriptional reprogramming

To investigate these potential relationships, researchers could:

  • Perform co-immunoprecipitation experiments with tagged ATP synthase components

  • Use super-resolution microscopy to visualize potential co-localization in the bacterial membrane

  • Create conditional expression systems to modulate ATP synthase levels and assess impacts on virulence

  • Implement metabolic flux analysis to track energy utilization during different infection phases

Understanding these interactions could reveal new therapeutic targets that disrupt the energetics of pathogenesis rather than targeting virulence factors directly.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.