Recombinant Yersinia pseudotuberculosis serotype IB Cardiolipin synthase (cls)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify it in your order; we will prioritize fulfilling such requests.
Synonyms
clsA; cls; YPTS_2180; Cardiolipin synthase A; CL synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
clsA
Target Protein Sequence
MTTFYTVISWLSVFGYWLLIAGVTLRILMKRRAVPSAMAWLLIIYILPLVGIIAYLSFGE LHLGKRRAERAKAMWPSTARWLSELKECQHIFANSNSEVATPLFQLCERRQGINGVKGNQ LQLLTTTDDTLKALVRDIELARHNIEMVFYIWQPGGLVDQVAESLMAAARRGVHCRLLLD SAGSKQFFRSPYPAMMRNAGIEVVEALKVNVFRMFLRRMDLRQHRKIVLIDNYVAYTGSM NMVDPRFFKQDAGVGQWIDMMARMEGPVATTLGIVYACDWEIETGKRILPPPPDANIMPF EEETGHTIQVIASGPGFPEEMIHQALLTAVYAAREQLIMTTPYFVPSDDLLHAICTAAQR GVDVSIIVPRENDSMMVRWASRAFFTELLNAGVKIYQFEGGLLHSKSVLVDGQLSLVGTV NLDMRSLWLNFEITLVIDDDGFGADLAQVQDDYIARSALLDGERWNKRPLWHRVTERLFY FFSPLL
Uniprot No.

Target Background

Function

This recombinant Yersinia pseudotuberculosis serotype IB Cardiolipin synthase (cls) catalyzes the reversible transfer of phosphatidyl groups between phosphatidylglycerol molecules, resulting in the formation of cardiolipin (CL, diphosphatidylglycerol) and glycerol.

Database Links
Protein Families
Phospholipase D family, Cardiolipin synthase subfamily, ClsA sub-subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cardiolipin synthase (cls) in Yersinia pseudotuberculosis?

Cardiolipin synthase (cls) is an enzyme encoded by the clsA gene that catalyzes the synthesis of cardiolipin, a crucial phospholipid component of bacterial membranes. In Yersinia pseudotuberculosis serotype O:1b, cls is a 486-amino acid protein containing two phospholipase D (PLD) active domains . The protein is identified in UniProt database under ID A7FI50 with several synonyms including clsA, YpsIP31758_1953, Cardiolipin synthase A, and CL synthase . Functionally, the enzyme plays a critical role in membrane phospholipid composition, which affects bacterial survival under various stress conditions and potentially contributes to pathogenicity.

What are the specifications of recombinant Y. pseudotuberculosis cls protein?

The recombinant full-length Y. pseudotuberculosis serotype O:1b Cardiolipin synthase protein is produced with the following specifications:

ParameterSpecification
SpeciesYersinia pseudotuberculosis serotype O:1b
SourceE. coli expression system
TagN-terminal His-tag
Protein LengthFull Length (1-486 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
ApplicationsSDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

The protein is typically purified using affinity chromatography that leverages the His-tag for selective binding, followed by additional purification steps to achieve high purity .

What are the optimal storage and handling conditions for the recombinant protein?

For optimal stability and activity of recombinant Y. pseudotuberculosis cls protein, the following storage and handling protocols are recommended:

  • Long-term storage: Store lyophilized powder at -20°C to -80°C upon receipt

  • Reconstitution: Briefly centrifuge the vial before opening and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Working aliquots: For multiple use, create working aliquots and store at 4°C for up to one week

  • Freeze-thaw protection: Add glycerol to a final concentration of 5-50% (with 50% being standard) before aliquoting for long-term storage

  • Critical precaution: Avoid repeated freeze-thaw cycles as they significantly decrease protein stability and activity

These guidelines ensure that the protein maintains its structural integrity and enzymatic activity for experimental applications.

How can researchers verify the quality of the recombinant cls protein?

Quality assessment of recombinant Y. pseudotuberculosis cls protein can be performed using several complementary techniques:

  • SDS-PAGE analysis: The primary method for assessing purity, with quality cls protein showing >90% purity on Coomassie-stained gels

  • Western blot: Using anti-His antibodies to confirm the presence of the His-tagged protein

  • Mass spectrometry: For precise molecular weight determination and verification of sequence integrity

  • Enzymatic activity assay: Using thin-layer chromatography or mass spectrometry to verify the protein can catalyze cardiolipin formation

  • Circular dichroism: To assess proper protein folding and secondary structure

Researchers should perform a combination of these methods to ensure both structural and functional quality of the protein before experimental use.

What role might Cardiolipin synthase play in Y. pseudotuberculosis' response to oxidative stress?

Y. pseudotuberculosis encounters significant oxidative stress during host colonization, as it must deal with reactive oxygen species (ROS) produced by host cells and microbiota in the digestive tract . While the specific role of cls in oxidative stress response isn't directly addressed in current literature, several mechanisms are likely:

  • Membrane protection: Cardiolipin-rich domains may protect bacterial cells by stabilizing membranes against oxidative damage

  • Respiratory chain interaction: Cardiolipin interacts with respiratory chain components that are major sources of reactive oxygen species

  • Complementary function to known defenses: Y. pseudotuberculosis possesses three H₂O₂-scavenging systems, including catalase/peroxidase KatE (primary scavenger for high H₂O₂ levels) and NADH peroxidase alkyl hydroperoxide reductase (AhpR) with catalase KatG for low H₂O₂ levels

Research methods to investigate cls in oxidative stress response include:

  • Comparing sensitivity to H₂O₂ and other oxidative agents in wild-type vs. cls mutants

  • Disk diffusion assays as described for oxidative stress testing

  • Transcriptomic analysis of cls expression under oxidative stress conditions

  • Lipidomic analysis to detect changes in cardiolipin content following oxidative challenge

How does the structure and function of cls contribute to Y. pseudotuberculosis pathogenicity?

The contribution of cls to Y. pseudotuberculosis pathogenicity likely involves several interconnected mechanisms:

  • Membrane composition alterations: The enzyme modifies bacterial membrane properties, potentially affecting interactions with host cells

  • Role in dissemination: Y. pseudotuberculosis exploits CD209 receptors for dissemination from gut to mesenteric lymph nodes, spleen, and liver ; membrane components influenced by cardiolipin may impact this process

  • Environmental adaptation: Y. pseudotuberculosis adapts to temperatures between 5°C-42°C , and cardiolipin synthesis may help maintain membrane fluidity across this range

  • Structural features: The two phospholipase D active domains in cls likely facilitate membrane remodeling during infection stages

Methodological approaches to investigate this include:

  • Constructing in-frame deletion strains as described for Y. pseudotuberculosis using att-based Fusion PCR method

  • Complementation studies with plasmid pHG-101 to verify phenotypes

  • Comparing virulence between wild-type and cls-deficient strains in animal models

  • Microscopy to visualize membrane dynamics during host cell interactions

How can recombinant cls protein be used in vaccine development research?

Recombinant Y. pseudotuberculosis proteins have significant potential in vaccine development, particularly against related pathogens like Y. pestis. The approaches include:

  • Membrane vesicle-based vaccines: Y. pseudotuberculosis has been remodeled to generate highly immunogenic outer membrane vesicles (OMVs) as plague vaccine candidates . Cls-modified strains could potentially enhance OMV production or composition.

  • Live attenuated vaccines: Attenuated Y. pseudotuberculosis strains with modifications like the triple mutation (Δasd ΔyopK ΔyopJ) have shown promise as live vaccine platforms .

  • Adjuvant development: As demonstrated in research:

    • A recombinant Y. pseudotuberculosis strain (Yptb) was designed to synthesize monophosphoryl lipid A (MPLA), an adjuvant form of lipid A

    • Intramuscular immunization with 40 μg of OMVs from modified Y. pseudotuberculosis (YptbS44-Bla-V) provided complete protection against Y. pestis infection

    • Oral prime-boost immunization induced potent antibody responses and provided protection against intranasal Y. pestis challenge

Methodological considerations include:

  • Assessment of T-cell responses using flow cytometry for CD3+, CD4+, and CD8+ T cells

  • Measurement of cytokine production (IFN-γ, IL-17A, TNF-α)

  • Challenge studies with different routes of infection (pulmonary, subcutaneous)

  • Comparative studies against existing vaccine candidates like F1V subunit vaccine

What methods can be used to assess the enzymatic activity of recombinant cls?

Analyzing the enzymatic activity of recombinant Y. pseudotuberculosis cls requires techniques that can detect the formation of cardiolipin from phosphatidylglycerol substrates:

  • Thin Layer Chromatography (TLC): Separates and visualizes phospholipids to monitor conversion of substrates to cardiolipin

  • Mass Spectrometry:

    • LC-MS/MS for precise quantification of reaction products

    • Can detect modifications in lipid A structure similar to the analysis methods used in Y. pseudotuberculosis lipid A studies

  • Radiolabeling assays:

    • Using ³²P-labeled substrates to track phospholipid conversion

    • Quantification by scintillation counting

  • Reconstituted systems:

    • In vitro assays using purified components

    • Liposome-based systems to mimic membrane environment

  • pH and temperature optimization:

    • Testing activity across temperatures (26°C vs. 37°C) as Y. pseudotuberculosis exhibits temperature-dependent traits

    • pH optimization considering the bacterium's environmental adaptability

How does the expression of cls gene change under different environmental conditions?

Y. pseudotuberculosis experiences diverse environments during its lifecycle, and cls expression likely responds to these changes. While cls-specific data is limited, methodologies for investigating gene expression patterns include:

  • RNA-seq analysis: Similar to the approach used for H₂O₂ stress response studies in Y. pseudotuberculosis , RNA-seq can reveal transcriptome-wide changes including cls expression.

  • Quantitative RT-PCR: As described for Y. pseudotuberculosis gene expression verification , qRT-PCR with appropriate normalization can track cls expression under conditions such as:

    • Temperature variation (26°C vs. 37°C)

    • Oxidative stress (sublethal H₂O₂ concentrations)

    • Nutrient limitation

    • Host cell contact

  • Promoter reporter systems: β-galactosidase activity assays using cls promoter constructs in plasmid pHGEI01 can monitor promoter activity under various conditions.

Research findings on Y. pseudotuberculosis gene expression indicate that:

  • H₂O₂ at 0.5 mM causes growth arrest without significant killing effect

  • Y. pseudotuberculosis is more sensitive to H₂O₂ than E. coli (MIC of 4 mM vs. 16 mM)

  • Temperature affects numerous traits including LPS structure and flagellar expression

These approaches would allow researchers to map the regulatory network controlling cls expression in response to environmental changes.

What comparative differences exist between cls in Y. pseudotuberculosis and related pathogenic species?

Comparative analysis of cls across Yersinia species reveals important evolutionary and functional insights:

  • Structural comparisons:

    • Multiple sequence alignment using tools like Clustal Omega can identify conserved regions and species-specific variations

    • Three-dimensional structure predictions using tools like Phyre2 allow visualization of potential functional differences

    • Phylogenetic analyses can place Y. pseudotuberculosis cls in evolutionary context relative to Y. pestis and Y. enterocolitica

  • Functional distinctions:

    • Y. pseudotuberculosis is closely related genetically to Y. pestis but causes different disease manifestations

    • Y. pestis evolved from Y. pseudotuberculosis relatively recently, making comparative studies particularly valuable

    • While Y. pseudotuberculosis causes gastrointestinal disease , Y. pestis causes plague - differences in membrane composition may contribute to these distinct pathologies

  • Regulatory variations:

    • Differential regulation has been observed between Y. pseudotuberculosis and Y. pestis for genes like hmsCDE

    • Similar regulatory differences may exist for cls expression between species

Research approaches include:

  • Complementation studies across species

  • Domain swapping experiments to identify functional determinants

  • Comparative genomics using available sequence data

How can researchers study the role of cls in Y. pseudotuberculosis biofilm formation?

Biofilm formation is an important virulence mechanism in Yersinia species, particularly for Y. pestis transmission by fleas. The potential role of cls in this process can be investigated through:

  • Relationship to known biofilm regulators:

    • Y. pseudotuberculosis biofilms are regulated by cyclic-di-GMP synthesized by diguanylate cyclases HmsT and HmsD

    • The Rcs phosphorelay system differentially regulates biofilm formation between Y. pseudotuberculosis and Y. pestis

    • Changes in membrane composition through cls activity may influence these regulatory systems

  • Methodological approaches:

    • Spotting assays as described for Y. pseudotuberculosis to evaluate plating defects

    • Crystal violet biofilm quantification assays

    • Microscopic analysis using fluorescent stains for biofilm matrix components

    • Complementation of cls mutants with plasmid-expressed cls to confirm phenotypes

  • Environmental factors:

    • Test biofilm formation at different temperatures, as Y. pseudotuberculosis exhibits temperature-dependent phenotypes (26°C vs. 37°C)

    • Evaluate the impact of oxidative stress on biofilm formation in wild-type vs. cls mutants

Understanding cls's role in biofilm formation may reveal new targets for antimicrobial interventions against Yersinia infections.

What techniques can be used to study cls protein localization in bacterial cells?

Understanding the subcellular localization of cls is crucial for elucidating its function in membrane biology. Several techniques can be employed:

  • Fluorescent protein fusion constructs:

    • C-terminal or N-terminal GFP fusions with cls

    • Live cell imaging to visualize dynamic localization patterns

    • Super-resolution microscopy to precisely map membrane localization

  • Immunolocalization:

    • Generation of specific antibodies against Y. pseudotuberculosis cls

    • Immunofluorescence microscopy on fixed cells

    • Immunogold electron microscopy for high-resolution localization studies

  • Membrane fractionation:

    • Separation of inner and outer membranes as described for Y. pseudotuberculosis studies

    • Western blot analysis of membrane fractions

    • Enzymatic activity assays of fractions to correlate localization with function

  • Environmental response:

    • Tracking localization changes under stress conditions

    • Correlation with membrane dynamics during infection processes

These approaches would help determine if cls localizes to specific membrane domains or associates with other protein complexes, providing insights into its physiological functions beyond simple enzymatic activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.