Recombinant Yersinia pseudotuberculosis serotype IB NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Specify your preferred tag type for prioritized development.
Synonyms
nuoA; YPTS_2682; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
nuoA
Target Protein Sequence
MRMSTTTEIIAHHWAFAVFLIGAVGLCGLMLLGAYFLGGRAQARAKNVPYESGIDSVGSA RMRLSAKFYLVAMFFVIFDVEALYLYAWSISIRESGWIGFIEAVIFILVLLAGLFYLVRI GALDWTPTRSNRRVSKPSTVRYASSHPQDISQELSVAGSQQANESR
Uniprot No.

Target Background

Function

NDH-1 (NADH-quinone oxidoreductase) facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediates. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled with proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby harnessing the redox energy as a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its function in Y. pseudotuberculosis?

NADH-quinone oxidoreductase subunit A (nuoA) is a critical component of Complex I (NDH-1) in the respiratory chain of Y. pseudotuberculosis. This enzyme complex serves as the first enzyme in the respiratory chain in most prokaryotic and eukaryotic cells . Specifically, nuoA functions within the membrane domain of the complex, where it contributes to proton translocation and energy conservation during the oxidation of NADH and reduction of quinones. The protein is encoded by the nuoA gene and is known alternatively as NADH dehydrogenase I subunit A, NDH-1 subunit A, or NUO1 . In Y. pseudotuberculosis serotype O:1b (strain IP 31758), the nuoA protein corresponds to UniProt accession number A7FGQ5 and is composed of 166 amino acid residues .

How does nuoA differ structurally and functionally from other subunits in the NADH-quinone oxidoreductase complex?

Unlike the antiporter-like subunits (NuoL, NuoM, and NuoN) that are structurally similar to each other, nuoA has a distinct structure and role in the NADH-quinone oxidoreductase complex. While NuoL, NuoM, and NuoN have been identified to contain conserved charged residues that are crucial for energy transduction (such as glutamate and lysine residues at specific positions), nuoA exhibits a different arrangement of transmembrane regions and functional domains .

The nuoA subunit in Y. pseudotuberculosis is characterized by several transmembrane regions contributing to its integration within the membrane domain of Complex I. Functional studies indicate that mutations in conserved charged residues of NuoM and NuoL lead to almost complete elimination of energy-transducing NDH-1 activities, whereas similar mutations in NuoN result in only moderate reductions (approximately 30%) in these activities . This suggests that despite structural similarities among some subunits, nuoA and other components of Complex I possess distinct functional roles in the energy transduction mechanism.

What are the optimal conditions for expression and purification of recombinant nuoA from Y. pseudotuberculosis?

When expressing and purifying recombinant nuoA from Y. pseudotuberculosis, researchers should consider the following methodological approach:

  • Expression System Selection: Use of E. coli-based expression systems is recommended due to their compatibility with membrane protein expression. BL21(DE3) strains with pET vector systems containing the nuoA gene have shown good results for similar proteins.

  • Induction Conditions: Optimize IPTG concentration (typically 0.1-0.5 mM) and induction temperature (preferably 16-20°C for membrane proteins) to enhance soluble protein yield.

  • Membrane Protein Extraction: Employ a gentle lysis method using a combination of lysozyme treatment and mild detergents (such as n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane-bound nuoA without denaturing its structure.

  • Purification Strategy: Implement a two-step purification process:

    • Initial capture using affinity chromatography (typically with a His-tag system)

    • Polishing step using size exclusion chromatography to enhance purity

  • Storage Conditions: Store the purified protein in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage to maintain protein stability and activity .

For quality control, researchers should verify the integrity of the purified protein using SDS-PAGE and Western blotting, and assess its functional activity through enzyme assays measuring NADH oxidation rates.

How should researchers design experiments to study nuoA's role in energy transduction mechanisms?

When designing experiments to investigate nuoA's role in energy transduction mechanisms, researchers should implement a multi-faceted approach:

  • Site-Directed Mutagenesis Strategy:

    • Identify conserved charged residues in nuoA based on sequence alignments with homologous proteins

    • Design mutations targeting these residues (particularly glutamate and lysine residues that may be involved in proton translocation)

    • Create a series of mutants with single, double, and conditional substitutions

  • Functional Assays:

    • Measure NADH oxidation rates using spectrophotometric assays

    • Assess proton pumping efficiency using pH-sensitive fluorescent probes

    • Determine membrane potential generation using potentiometric dyes

    • Compare wild-type and mutant activities under various conditions

  • Structural Analysis Integration:

    • Combine functional data with structural information from techniques such as cryo-EM

    • Map the identified functional residues onto structural models

    • Use molecular dynamics simulations to predict the effects of mutations

  • Experimental Design Statistical Approach:

    • Implement central composite design (CCD) methods to systematically vary experimental factors

    • Utilize face-centered (CCF) designs to ensure factors remain within realistic ranges

    • Apply response surface methodology to model complex interactions between factors

What methodologies are recommended for studying interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex?

To effectively study interactions between nuoA and other subunits of the NADH-quinone oxidoreductase complex, researchers should employ the following methodologies:

  • Crosslinking Studies:

    • Utilize chemical crosslinkers with varying spacer arm lengths to capture interactions

    • Apply photo-activatable crosslinkers for capturing transient interactions

    • Analyze crosslinked products using mass spectrometry to identify interaction interfaces

  • Co-immunoprecipitation Approaches:

    • Develop specific antibodies against nuoA and other subunits

    • Perform pull-down assays to identify interacting partners

    • Use reciprocal co-IP to confirm direct interactions

  • FRET/BRET Analysis:

    • Engineer fluorescent protein fusions to nuoA and potential interacting subunits

    • Measure energy transfer as an indicator of proximity and interaction

    • Use site-specific labeling strategies to map interaction domains

  • Bacterial Two-Hybrid Systems:

    • Adapt bacterial two-hybrid assays to test specific interactions

    • Design constructs that maintain proper membrane orientation of proteins

    • Validate positive results with alternative interaction assays

  • Cryo-EM and Structural Approaches:

    • Isolate intact respiratory complexes containing nuoA

    • Analyze subunit arrangements and interfaces using high-resolution cryo-EM

    • Develop computational models of subunit interactions based on structural data

When conducting these studies, it's important to consider that mutations in corresponding glutamic acids in NuoM and NuoL can lead to almost total elimination of energy-transducing NDH-1 activities, while similar mutations in NuoN cause only moderate reductions (approximately 30%) . This functional difference highlights the importance of understanding the distinct roles and interactions of each subunit within the complex.

How can researchers address contradictions in experimental data related to nuoA function?

When facing contradictory experimental data regarding nuoA function, researchers should implement a systematic approach to resolution:

  • Contradiction Identification Framework:

    • Classify contradictions by type (methodological, interpretative, or fundamental)

    • Document specific parameters that differ between contradictory studies

    • Assess whether contradictions relate to core findings or peripheral observations

  • Methodological Reconciliation:

    • Compare experimental conditions in detail (buffer compositions, protein preparations, assay conditions)

    • Reproduce key experiments using standardized protocols to eliminate methodological variables

    • Implement statistical design of experiments (DOE) approaches to systematically explore parameter space

  • Data Integration Techniques:

    • Apply meta-analysis methods to quantitatively synthesize results across studies

    • Use Bayesian approaches to incorporate prior knowledge with new experimental data

    • Develop computational models that can accommodate apparently contradictory observations

  • Contradiction Resolution Strategy:

    • Design critical experiments specifically targeted at resolving contradictory findings

    • Consider organism-specific or strain-specific differences that might explain divergent results

    • Explore environmental or contextual factors that might influence nuoA function

  • Documentation and Reporting:

    • Clearly document conditions that lead to different functional outcomes

    • Report both supporting and contradicting evidence in publications

    • Distinguish between established facts and interpretations when discussing contradictory data

Recent advances in clinical contradiction detection methodologies can be adapted to scientific literature analysis, providing computational approaches to identify and classify contradictions in published work related to nuoA and other respiratory chain components .

What statistical approaches are most appropriate for analyzing complex data from nuoA functional studies?

For analyzing complex data from nuoA functional studies, researchers should employ sophisticated statistical approaches tailored to the specific experimental design:

  • Design of Experiments (DOE) Framework:

    • Implement central composite design (CCD) approaches to efficiently explore experimental parameter space

    • Utilize face-centered designs (CCF) to constrain experimental factors within biologically relevant ranges

    • Apply response surface methodology to model complex interactions between experimental factors

  • Multivariate Analysis Methods:

    • Use principal component analysis (PCA) to identify patterns in high-dimensional data

    • Apply partial least squares (PLS) regression for correlating multiple dependent and independent variables

    • Implement cluster analysis to identify functional groupings of mutations or conditions

  • Time Series Analysis for Kinetic Data:

    • Apply non-linear regression models to enzyme kinetics data

    • Use mixed-effects models to account for both fixed and random factors in experimental designs

    • Implement time-frequency analysis for oscillatory behaviors in proton pumping or electron transfer

  • Statistical Validation Framework:

    • Conduct power analysis to ensure adequate sample sizes for detecting biologically relevant effects

    • Implement appropriate multiple testing corrections for high-throughput screening data

    • Use bootstrapping or permutation tests for robust statistical inference when parametric assumptions are violated

  • Data Visualization Strategies:

    • Develop custom visualization approaches for complex multidimensional data

    • Use interactive visualization tools to explore relationships between experimental factors

    • Implement heat maps and network diagrams to represent interaction data

When analyzing the effects of site-directed mutations on nuoA function, researchers should consider that the impact may vary considerably depending on the specific residue modified, as observed in comparative studies of NuoN, NuoM, and NuoL, where mutations of corresponding glutamic acids produced dramatically different functional consequences .

How can researchers distinguish between direct effects of nuoA mutations and indirect effects on complex assembly or stability?

Distinguishing between direct functional effects of nuoA mutations and indirect effects on complex assembly or stability requires a multi-faceted experimental approach:

  • Comprehensive Characterization Framework:

    • Analyze both in vivo and in vitro properties of mutant proteins

    • Assess protein expression levels, membrane localization, and complex incorporation

    • Evaluate stability of isolated complexes containing mutant subunits

    • Measure functional parameters independently from complex assembly

  • Analytical Techniques for Complex Integrity:

    TechniqueApplicationOutcome Measure
    Blue Native PAGEComplex integrityMigration pattern of intact complexes
    Size Exclusion ChromatographyComplex stabilityElution profile and complex size
    Analytical UltracentrifugationComplex stoichiometrySedimentation coefficients
    Cryo-EMStructural arrangement3D structure of assembled complex
    Protease Sensitivity AssayProtein foldingDigestion pattern differences
  • Functional Assays Independent of Assembly:

    • Develop reconstitution systems to assess function of isolated components

    • Use complementation studies in deletion mutants to evaluate in vivo functionality

    • Implement conditional expression systems to control timing of protein production

  • Correlation Analysis Strategy:

    • Systematically correlate expression levels with functional parameters

    • Compare complex assembly efficiency with functional readouts

    • Develop mathematical models that separate assembly and functional effects

  • Control Mutation Design:

    • Create control mutations known to affect only structure or only function

    • Design mutations outside critical functional residues but affecting stability

    • Implement temperature-sensitive mutations to conditionally destabilize the complex

When interpreting results, researchers should consider that mutations in different subunits may have varying effects on complex assembly and function. For example, studies of the antiporter-like subunits (NuoN, NuoM, and NuoL) have shown that mutations of corresponding residues can have dramatically different impacts on energy-transducing activities , suggesting complex and non-equivalent roles of these structurally similar subunits.

How might nuoA from Y. pseudotuberculosis be engineered for enhanced activity or stability?

Engineering nuoA from Y. pseudotuberculosis for enhanced activity or stability requires rational design approaches informed by structure-function relationships:

  • Rational Engineering Strategy:

    • Identify conserved residues across species that might be modified for improved properties

    • Compare nuoA sequences from extremophiles to identify potential stability-enhancing substitutions

    • Map functionally critical regions to preserve while modifying peripheral regions

    • Use computational protein design to predict stabilizing mutations

  • Directed Evolution Approach:

    • Develop high-throughput screening methods for nuoA activity

    • Implement error-prone PCR to generate mutation libraries

    • Use gene shuffling between homologous nuoA genes from different species

    • Apply selective pressure to identify variants with desired properties

  • Stability Enhancement Techniques:

    • Introduce disulfide bonds at strategic positions to enhance structural rigidity

    • Optimize surface charge distribution to improve solubility

    • Modify hydrophobic core packing for increased thermal stability

    • Engineer pH-resistant variants through modification of titratable groups

  • Activity Enhancement Methods:

    • Modify residues in proton channels to increase proton translocation efficiency

    • Engineer interface regions to optimize interactions with other complex subunits

    • Adjust substrate binding regions to enhance NADH-binding affinity or product release

    • Create chimeric proteins incorporating high-activity domains from homologous proteins

  • Experimental Design Optimization:

    • Implement central composite design (CCD) approaches to efficiently explore mutation combinations

    • Use face-centered designs (CCF) to constrain modifications within folding-competent parameter space

    • Apply sequential screening strategies to progressively refine engineered variants

When engineering membrane proteins like nuoA, researchers must carefully balance modifications to maintain proper membrane insertion, folding, and assembly into the larger respiratory complex while enhancing desired functional properties.

What are the implications of nuoA structure and function for developing novel antimicrobial strategies?

The unique structure and function of nuoA in Y. pseudotuberculosis present several opportunities for novel antimicrobial development:

  • Target Vulnerability Assessment:

    • Evaluate essentiality of nuoA for bacterial survival under various conditions

    • Determine structural differences between bacterial and mammalian homologs to enable selective targeting

    • Identify critical residues unique to bacterial nuoA that could serve as specific binding sites

    • Assess the potential for resistance development through mutation analysis

  • Inhibition Strategy Development:

    • Design small molecule inhibitors targeting the active site or proton translocation pathway

    • Develop peptide-based inhibitors that disrupt nuoA interaction with other complex subunits

    • Create allosteric inhibitors that lock the protein in an inactive conformation

    • Engineer nucleic acid-based approaches (antisense, CRISPR) to reduce nuoA expression

  • Screening Methodologies:

    • Establish high-throughput assays for nuoA activity inhibition

    • Develop whole-cell screening platforms with reporter systems linked to respiratory function

    • Implement fragment-based drug discovery approaches to identify initial chemical scaffolds

    • Use virtual screening to predict potential inhibitors based on nuoA structure

  • Therapeutic Development Considerations:

    • Assess membrane permeability of potential inhibitors

    • Evaluate cytotoxicity against mammalian cells to ensure safety

    • Determine efficacy in infection models

    • Study pharmacokinetic and pharmacodynamic properties of lead compounds

  • Combination Strategy Exploration:

    • Investigate synergistic effects between nuoA inhibitors and existing antibiotics

    • Develop dual-target inhibitors affecting both nuoA and other respiratory components

    • Explore potential for antivirulence effects through partial inhibition of respiratory function

By targeting nuoA and the NADH-quinone oxidoreductase complex, researchers may develop novel antimicrobials effective against Y. pseudotuberculosis and related pathogens that rely on this respiratory enzyme for energy production and survival.

How does the function of nuoA in Y. pseudotuberculosis compare to homologous proteins in other bacterial pathogens?

Comparative analysis of nuoA across bacterial pathogens reveals important evolutionary and functional insights:

  • Sequence Conservation Analysis:

    • Alignments show varying degrees of conservation in key functional domains

    • Identification of organism-specific insertions or deletions that may confer unique properties

    • Analysis of selection pressure on different regions indicates functional constraints

    • Comparative assessment of charged residues involved in proton translocation

  • Structural Comparison Framework:

    • Analysis of transmembrane domain organization across species

    • Evaluation of species-specific differences in critical loops or interaction interfaces

    • Assessment of differences in cofactor binding sites or proton channels

    • Comparison of oligomeric state and complex assembly mechanisms

  • Functional Divergence Assessment:

    • Comparative enzymatic parameters (Km, Vmax, pH optima) across species

    • Differences in proton translocation efficiency and energy conservation

    • Species-specific regulatory mechanisms controlling complex I activity

    • Variations in inhibitor sensitivity providing insights into binding site differences

  • Physiological Role Comparison:

    OrganismEnvironmental NichenuoA Role SpecificityNotable Adaptations
    Y. pseudotuberculosisIntestinal pathogenCore respiratory functionTemperature adaptation mechanisms
    E. coliVersatile entericWell-characterized modelExtensively studied mutations
    MycobacteriaIntracellular pathogenAlternative NADH dehydrogenasesUnique complex I composition
    Vibrio speciesAquatic environmentsSalt tolerance adaptationsHalotolerant protein modifications
  • Evolutionary Implications:

    • Analysis of horizontal gene transfer events affecting nuoA

    • Assessment of co-evolution with other complex I subunits

    • Identification of lineage-specific adaptations in respiratory metabolism

    • Correlation between nuoA variations and ecological niches or pathogenicity

Understanding the similarities and differences in nuoA across bacterial species provides valuable insights for both basic research and applied studies aimed at developing targeted antimicrobial strategies or engineered proteins with enhanced properties for biotechnological applications.

What are the most significant recent advances in understanding nuoA function and structure?

Recent advances in understanding nuoA function and structure have significantly expanded our knowledge of this critical respiratory chain component:

  • The comparative analysis of antiporter-like subunits (NuoL, NuoM, and NuoN) has revealed distinct functional roles despite structural similarities, suggesting nuoA has evolved specific adaptations for its role in the respiratory complex .

  • High-resolution structural studies have provided unprecedented insights into the arrangement of transmembrane helices and the organization of charged residues potentially involved in proton translocation.

  • Mutational studies have identified key residues essential for nuoA function, with particular emphasis on conserved charged amino acids that contribute to energy transduction mechanisms .

  • Advanced experimental design methodologies, including central composite design approaches, have enabled more systematic exploration of factors affecting nuoA function and complex assembly .

  • The development of contradiction detection methodologies has improved our ability to reconcile apparently conflicting experimental results regarding nuoA function, leading to more coherent models of its role in respiratory metabolism .

These advances collectively provide a foundation for future research directions, including the potential development of targeted antimicrobials, engineered variants with enhanced properties, and deeper understanding of bacterial energy metabolism.

What research gaps remain to be addressed in the study of Y. pseudotuberculosis nuoA?

Despite significant progress, several important research gaps remain in our understanding of Y. pseudotuberculosis nuoA:

  • The precise mechanistic details of how nuoA contributes to proton translocation and energy conservation in Complex I remain incompletely characterized, particularly regarding the coordination with other subunits.

  • The structural dynamics of nuoA during the catalytic cycle have not been fully elucidated, limiting our understanding of conformational changes associated with function.

  • Species-specific adaptations of nuoA in Y. pseudotuberculosis compared to other bacterial pathogens require further investigation to understand niche-specific optimizations.

  • The potential of nuoA as a target for antimicrobial development has not been systematically explored, despite its critical role in bacterial energy metabolism.

  • The regulatory mechanisms controlling nuoA expression and activity under different environmental conditions, including during host infection, remain poorly characterized.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.