Recombinant Yersinia pseudotuberculosis serotype IB NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant nuoK protein is produced in E. coli via heterologous expression systems.

Production Parameters:

AspectDetails
Expression HostE. coli
TagN-terminal His-tag for affinity chromatography
Purity≥85% (SDS-PAGE)
StorageTris-based buffer with 50% glycerol, stored at -20°C

Functional Roles in Bacterial Metabolism

NuoK is integral to NDH-1’s energy-transducing mechanism. Mutational studies reveal its role in proton translocation and electron transfer:

Critical Mutations and Functional Impacts

MutationEnzyme Activity (% WT)Proton TranslocationReference
E36A (Glu-36 → Ala)3% (NADH-O₂), 5% (NADH-DB)Abolished
E72A (Glu-72 → Ala)52% (NADH-O₂), 54% (NADH-DB)Partially impaired
R25A (Arg-25 → Ala)55% (NADH-O₂), 54% (NADH-DB)Reduced
R26A (Arg-26 → Ala)72% (NADH-O₂), 68% (NADH-DB)Moderate reduction

Key Findings:

  • Glu-36 in TM2 is indispensable for proton pumping, as its mutation (E36A) abolishes NDH-1 activity .

  • Glu-72 in TM3 contributes to proton translocation but is less critical than Glu-36 .

  • Arg-25/26 in loop-1 stabilize NDH-1’s quaternary structure and modulate electron transfer efficiency .

Mechanistic Studies

NuoK mutants (e.g., E36A, E72A) are used to dissect the proton translocation pathway in NDH-1. For example:

  • Repositioning Glu-36: Mutants relocating Glu-36 to positions 32, 38, 39, or 40 in TM2 retained partial activity (52–75% of WT), suggesting helix-phase flexibility in proton transfer .

Vaccine Development

While not directly involving nuoK, recombinant Y. pseudotuberculosis strains (e.g., χ10069) are engineered for vaccine delivery, leveraging attenuated virulence factors . This highlights the broader utility of recombinant Yersinia proteins in biomedical research.

Genomic Context

The nuoK gene is conserved in Y. pseudotuberculosis genomes, including serotype IB strains. Comparative genomics reveals that lateral gene acquisition, rather than gene loss, drives species-specific adaptation in this pathogen .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such requirements in your order remarks, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing that tag.
Synonyms
nuoK; YPTS_2673; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
nuoK
Target Protein Sequence
MIPLQHGLILAAILFVLGLTGLLIRRNLLFMLISLEVMINAAALAFVVAGSYWGQADGQV MYILAITLAAAEASIGLALLLQLYRRRHTLDIDTVSEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this specific species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples this redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K (nuoK) in Yersinia pseudotuberculosis?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical component of the bacterial respiratory chain complex I in Yersinia pseudotuberculosis. This membrane-embedded subunit contributes to the proton-translocating function of the enzyme complex, facilitating energy conservation during electron transport. Within the Y. pseudotuberculosis metabolic network, nuoK functions as part of the larger NADH dehydrogenase complex that catalyzes the transfer of electrons from NADH to quinone coupled with proton translocation across the membrane, generating the proton motive force required for ATP synthesis .

How does Y. pseudotuberculosis serotype IB differ from other serotypes in terms of genetic characteristics?

Y. pseudotuberculosis serotype IB (as seen in strains like PB1+) differs from other serotypes primarily in its O-antigen structure, which is determined by the O-antigen gene cluster. Serotype IB strains like the PB1+ strain described in the literature demonstrate distinct colonization patterns in intestinal tissues, with efficient targeting of Peyer's patches during early infection . Importantly, serotype IB strains can be engineered with specific mutations (such as ΔyopK ΔyopJ Δasd) to develop attenuated vaccine vectors while maintaining their ability to colonize intestinal lymphoid tissues, making them valuable candidates for vaccine development .

What genetic manipulation techniques are commonly used for studying nuoK function in Y. pseudotuberculosis?

The primary genetic manipulation techniques employed for studying nuoK function in Y. pseudotuberculosis include:

  • Targeted gene deletion via homologous recombination

  • Transposon mutagenesis, particularly signature-tagged mutagenesis (STM) for high-throughput screening

  • Complementation studies using plasmid-based expression systems

  • Site-directed mutagenesis for analyzing specific amino acid residues

For example, signature-tagged mutagenesis has been effectively utilized to identify attenuated Y. pseudotuberculosis strains through random insertion of tagged transposons (such as pUTminiTn5Kn2+tags), followed by infection studies and recovery analysis . Similar approaches could be applied specifically to nuoK to study its function in bacterial metabolism and virulence.

What are the optimal conditions for expressing recombinant Y. pseudotuberculosis nuoK protein?

For optimal expression of recombinant Y. pseudotuberculosis nuoK protein, the following experimental conditions are recommended:

ParameterOptimal ConditionNotes
Expression SystemE. coli BL21(DE3) or similar strainsHost strains deficient in proteases are preferred
Growth Temperature26-30°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGFor T7-based expression systems
Growth Media2xYT supplemented with 5 mM CaCl₂As used for Y. pseudotuberculosis cultivation
Harvest Time4-6 hours post-inductionLonger expression times may lead to degradation
Membrane ExtractionDetergent solubilization (n-Dodecyl β-D-maltoside)Critical for membrane proteins like nuoK

When expressing membrane proteins like nuoK, it's critical to optimize detergent concentration during purification to maintain protein stability and function. Western blot analysis with appropriate antibodies can be used to confirm expression, similar to the techniques used for detecting other Y. pseudotuberculosis proteins .

How can researchers effectively create and validate nuoK knockout mutants in Y. pseudotuberculosis?

To create and validate nuoK knockout mutants in Y. pseudotuberculosis:

  • Design Strategy: Use either lambda Red recombination or suicide vector-based approaches with antibiotic selection markers.

  • Knockout Construction:

    • Amplify ~1 kb flanking regions upstream and downstream of nuoK

    • Join these regions with an antibiotic resistance cassette

    • Clone into a suicide vector (e.g., pKNG101 with sacB counter-selection)

    • Transfer into Y. pseudotuberculosis via conjugation using strains such as E. coli SM10λpir

  • Selection and Screening:

    • Select for single crossover events using antibiotic resistance

    • Counter-select for double crossover events using sucrose sensitivity (5-10% sucrose)

    • Screen colonies by PCR to verify nuoK deletion

  • Validation Methods:

    • PCR verification of gene deletion

    • Whole-genome sequencing to confirm clean deletion without secondary mutations

    • RT-qPCR to verify absence of nuoK transcription

    • Phenotypic characterization including growth curves in different carbon sources

    • Complementation studies to restore wild-type phenotype

  • Colonization Assessment:

    • Evaluate mutant colonization capacity in mouse models, focusing on Peyer's patches, cecum, and mesenteric lymph nodes using methods similar to those described for other Y. pseudotuberculosis mutants

What mouse models are most appropriate for studying the impact of nuoK mutations on Y. pseudotuberculosis virulence?

The following mouse models are most appropriate for studying the impact of nuoK mutations on Y. pseudotuberculosis virulence:

  • Swiss Webster mice - This outbred strain has been successfully used to evaluate Y. pseudotuberculosis colonization and immune responses. These mice can be orally administered with ~10⁹ CFU of bacteria to assess colonization patterns in Peyer's patches, livers, spleens, and lungs over time .

  • C57BL/6 mice - This inbred strain provides consistent genetic background for reproducible infection studies and is compatible with various immunological tools.

  • Infection Routes and Doses:

    • Orogastric infection: 2 × 10⁷ to 2 × 10⁹ CFU (the oral LD₅₀ for wild-type Y. pseudotuberculosis is approximately 2 × 10⁷ bacteria)

    • Intraperitoneal infection: For assessing systemic dissemination independent of gut colonization

  • Tissue Collection Timeline:

    • Early infection: 1-3 days post-infection for intestinal colonization assessment

    • Established infection: 5-9 days post-infection for systemic dissemination

  • Recommended Analyses:

    • Bacterial burden in intestinal tissues (Peyer's patches, cecum)

    • Dissemination to mesenteric lymph nodes, spleen, and liver

    • Histopathological examination of infected tissues

    • Flow cytometric analysis of immune cell populations

    • Survival studies to determine virulence attenuation

How does nuoK contribute to Y. pseudotuberculosis survival under oxidative stress conditions?

The NADH-quinone oxidoreductase complex, including the nuoK subunit, plays a crucial role in Y. pseudotuberculosis survival under oxidative stress conditions through several mechanisms:

  • Redox Balance Maintenance: The complex helps maintain cellular redox homeostasis by oxidizing NADH, preventing excessive accumulation of reducing equivalents that can enhance oxidative damage.

  • PMF Generation: By contributing to proton motive force (PMF) generation, nuoK indirectly supports ATP-dependent stress response systems and repair mechanisms.

  • Respiratory Flexibility: The NADH dehydrogenase complex provides respiratory flexibility, allowing the bacterium to adapt to changing environmental conditions during infection.

  • Integration with Virulence Mechanisms: The respiratory chain function likely interfaces with virulence mechanisms, as Y. pseudotuberculosis must adapt its metabolism when transitioning between environmental survival and host infection phases.

Research approaches to investigate this relationship include:

  • Measuring survival rates of nuoK mutants versus wild-type strains when exposed to hydrogen peroxide or superoxide-generating compounds

  • Analyzing transcriptional responses of oxidative stress genes in nuoK mutants

  • Assessing intracellular redox state using redox-sensitive fluorescent probes

  • Examining the interaction between respiratory chain function and Yop effector expression, as Yops are known to counteract host immune responses including respiratory burst

What is the relationship between nuoK function and the type III secretion system (T3SS) activity in Y. pseudotuberculosis?

While direct evidence linking nuoK function to T3SS activity is limited, significant conceptual connections can be made based on the energetic requirements of T3SS and the role of the respiratory chain:

  • Energy Dependencies: The T3SS apparatus requires significant energy for assembly and operation. As part of the respiratory chain, nuoK contributes to PMF generation, which may influence energy availability for T3SS function.

  • Regulatory Crosstalk: Both respiratory metabolism and T3SS are regulated in response to environmental conditions. For example, T3SS components like Yops are secreted under specific calcium-deprived conditions at 37°C , which may coincide with metabolic adaptations involving the respiratory chain.

  • Potential Research Approaches:

    • Analysis of T3SS protein secretion efficiency in nuoK mutants under standard low-calcium induction conditions

    • Investigation of whether nuoK mutations affect the calcium and temperature sensing mechanisms that regulate T3SS

    • Measurement of intracellular ATP levels and membrane potential in nuoK mutants and correlation with T3SS activity

    • Evaluation of T3SS-dependent virulence phenotypes in nuoK mutants, such as resistance to phagocytosis by PMNs

Current research has demonstrated that Y. pseudotuberculosis effectively escapes polymorphonuclear neutrophils through the action of T3SS-delivered Yop effectors , suggesting that any impairment in energy metabolism due to nuoK mutations might indirectly affect this critical virulence mechanism.

How can recombinant Y. pseudotuberculosis nuoK be utilized in vaccine development strategies?

Recombinant Y. pseudotuberculosis nuoK could be leveraged in vaccine development through several innovative approaches:

  • Attenuated Strain Development:

    • nuoK mutation could be combined with other attenuating mutations (ΔyopK, ΔyopJ, Δasd) to develop safe vaccine vectors with controlled colonization properties

    • The resulting strains could be assessed for colonization patterns in Peyer's patches and systemic tissues, similar to existing attenuated strains

  • Antigen Delivery Platform:

    • Similar to the Y. pseudotuberculosis strain χ10069 that delivers YopE-LcrV fusion proteins , a nuoK-modified strain could be engineered to deliver heterologous antigens

    • The respiratory chain alteration could be fine-tuned to allow sufficient colonization for immune stimulation while preventing pathogenicity

  • Adjuvant Properties:

    • Bacterial components like nuoK could potentially serve as adjuvants to enhance immune responses

    • Purified recombinant nuoK could be tested for its ability to stimulate innate immune receptors

  • Immunological Evaluation Matrix:

ParameterMeasurement MethodExpected Outcome
Mucosal ImmunityIgA in intestinal lavageEnhanced mucosal antibody responses
Systemic ImmunitySerum IgG, IgM levelsProtection against systemic challenge
T-cell ResponsesIFN-γ ELISPOT, CD4/CD8 profilingBalanced Th1/Th2/Th17 responses
Protective EfficacyChallenge with virulent strainReduced bacterial burden, enhanced survival
Safety ProfileHistopathology, weight monitoringNo adverse effects in vaccinated animals
  • Potential Advantages:

    • Natural targeting of intestinal lymphoid tissues by Y. pseudotuberculosis

    • Controlled attenuation through specific metabolic impairment

    • Potential for oral administration, similar to other Y. pseudotuberculosis vaccine vectors

How can researchers differentiate phenotypes caused by nuoK mutation from those resulting from polar effects on adjacent genes?

Differentiating direct nuoK mutation effects from polar effects requires systematic experimental approaches:

  • Complementation Analysis:

    • Single-gene complementation: Express nuoK alone from a plasmid in the mutant strain

    • Operon complementation: Express the entire nuo operon to assess multi-gene effects

    • Compare phenotypic restoration: Differences between single-gene and operon complementation suggest polar effects

  • Targeted Mutation Strategies:

    • Use scarless deletion methods that preserve reading frames and regulatory elements

    • Introduce silent mutations or amino acid substitutions rather than complete deletions

    • Create point mutations in catalytic residues to disrupt function without affecting expression

  • Transcriptional Analysis:

    • Perform RT-qPCR on genes downstream of nuoK to quantify expression levels

    • Use RNA-Seq to assess global transcriptional changes

    • Compare transcriptomes of clean deletion mutants versus point mutants

  • Protein Expression Verification:

    • Quantify expression levels of other Nuo complex subunits via Western blotting

    • Use antibodies against downstream gene products to confirm expression

  • Phenotypic Characterization Matrix:

Strain TypeGrowth RateRespirationColonizationT3SS Function
Wild-type++++++++++++
nuoK deletion+++?
nuoK point mutant++++?
nuoK complemented++++++++++++
Operon complemented++++++++++++

This systematic approach, similar to methods used to characterize Y. pseudotuberculosis yop mutants , will help distinguish direct effects of nuoK mutation from polar effects on adjacent genes.

What statistical approaches are most appropriate for analyzing colonization and dissemination data when evaluating nuoK mutants?

  • Data Transformation and Normalization:

    • Log-transform CFU data to achieve normal distribution

    • Consider using geometric means rather than arithmetic means for bacterial counts

    • Normalize data to account for variations in inoculum size between experiments

  • Appropriate Statistical Tests:

    • For comparing two groups (e.g., wild-type vs. nuoK mutant):

      • Student's t-test (parametric) if data is normally distributed

      • Mann-Whitney U test (non-parametric) if normality cannot be assumed

    • For multiple group comparisons:

      • One-way ANOVA with post-hoc tests (Tukey, Bonferroni) for parametric data

      • Kruskal-Wallis with Dunn's post-test for non-parametric data

    • For time-course experiments:

      • Two-way ANOVA with repeated measures

      • Mixed-effects models to account for missing data points

  • Sample Size Determination:

    • Power analysis to determine appropriate group sizes

    • Typical infection studies require 5-10 animals per group per time point

    • Consider biological replicates (different animals) and technical replicates (multiple samples per animal)

  • Advanced Analytical Approaches:

    • Survival analysis (Kaplan-Meier with log-rank test) for mortality studies

    • Principal Component Analysis (PCA) to identify patterns in multi-parameter data

    • Machine learning approaches for identifying complex phenotypic signatures

  • Data Visualization:

    • Dot plots with means and standard deviations for CFU counts

    • Box-and-whisker plots to show data distribution

    • Heat maps for multi-tissue, multi-timepoint comparisons

Similar statistical approaches have been successfully applied in analyzing colonization patterns of Y. pseudotuberculosis strains in different tissues over time, as demonstrated in the literature .

How does the structure-function relationship of nuoK in Y. pseudotuberculosis compare to homologous proteins in other bacterial pathogens?

The structure-function relationship of nuoK in Y. pseudotuberculosis can be compared to homologous proteins in other bacterial pathogens by examining several key aspects:

  • Structural Conservation:

    • nuoK typically contains three transmembrane helices that contribute to the membrane arm of complex I

    • Sequence alignment across pathogenic species reveals highly conserved residues involved in proton translocation

    • Structure prediction tools suggest similar folding patterns across Enterobacteriaceae family members

  • Comparative Analysis Table:

Bacterial PathogennuoK Homology to Y. pseudotuberculosisKey Structural DifferencesFunctional Implications
Y. pestis>99% identityNearly identicalSimilar role in respiratory metabolism
E. coli~85-90% identityMinor variations in transmembrane domainsPotentially altered proton pumping efficiency
Salmonella spp.~80-85% identityDifferences in loop regionsMay affect interaction with other subunits
Pseudomonas aeruginosa~50-60% identitySignificant differences in quinone-binding regionAdapted to different electron carriers
  • Functional Conservation:

    • The core function in proton translocation is preserved across species

    • Species-specific adaptations may reflect different metabolic requirements during infection

    • Some pathogens show adaptations in respiratory chain components related to their specific niche (aerobic vs. microaerobic)

  • Research Approaches:

    • Complementation studies using nuoK from different pathogens in Y. pseudotuberculosis nuoK mutants

    • Site-directed mutagenesis of non-conserved residues to identify species-specific functional adaptations

    • Structural biology approaches (cryo-EM) to resolve species-specific differences in complex I architecture

  • Pathogenesis Connection:

    • Comparative studies could reveal how respiratory chain adaptations contribute to virulence in different pathogens

    • Understanding of nuoK function could provide insights into bacterial adaptation to host environments where oxygen availability varies

What emerging technologies could advance our understanding of nuoK function in Y. pseudotuberculosis metabolism and virulence?

Several emerging technologies show promise for advancing our understanding of nuoK function:

  • CRISPR-Cas9 Genome Editing:

    • Precise genome modifications without antibiotic markers

    • Creation of single amino acid substitutions to study specific functional domains

    • Multiplexed mutations to study interactions with other respiratory components

  • Single-Cell Technologies:

    • Single-cell RNA-Seq to examine heterogeneity in bacterial populations during infection

    • Single-cell metabolomics to detect metabolic changes in nuoK mutants

    • Microfluidics platforms to study real-time bacterial responses to changing environments

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize respiratory complexes in bacterial membranes

    • Correlative light and electron microscopy to connect structure with function

    • Cryo-electron tomography to visualize respiratory chain organization in situ

  • Metabolic Flux Analysis:

    • ¹³C metabolic flux analysis to quantify changes in central carbon metabolism

    • Real-time measurement of oxygen consumption and proton translocation

    • Integration with proteomics data to create comprehensive metabolic models

  • Host-Pathogen Interaction Technologies:

    • Organoid infection models to study tissue-specific interactions

    • Intravital microscopy to visualize bacterial behavior in living tissues

    • CRISPR screening of host factors that interact with bacterial respiratory machinery

  • Application Matrix:

TechnologyApplication to nuoK ResearchExpected Insights
CRISPRi/CRISPRaTunable expression of nuoKDose-dependent effects on metabolism
Bacterial Cytological ProfilingPhenotypic responses to nuoK modulationCellular adaptations to respiratory changes
Dual RNA-SeqHost-pathogen transcriptional changesImpact on host-pathogen interfaces
Protein Structure Prediction (AlphaFold)nuoK structural modelingStructure-based functional hypotheses
MetabolomicsMetabolite profiling in nuoK mutantsMetabolic rewiring during adaptation

How might nuoK function in Y. pseudotuberculosis relate to its ability to survive in diverse environmental conditions?

The nuoK function in Y. pseudotuberculosis likely plays a crucial role in the pathogen's ability to survive in diverse environmental conditions:

  • Adaptation to Oxygen Availability:

    • Y. pseudotuberculosis encounters varying oxygen concentrations during its lifecycle

    • In the intestinal environment, oxygen gradients exist from the lumen to the epithelium

    • nuoK, as part of complex I, may contribute to respiratory flexibility needed during transition from environmental to host conditions

  • Temperature Adaptation:

    • Y. pseudotuberculosis can grow at temperatures ranging from 4°C (environmental) to 37°C (mammalian host)

    • Respiratory chain composition and efficiency may need to adapt to these temperature shifts

    • nuoK function could be temperature-dependent, affecting energy production differently at various temperatures

  • pH and Ionic Strength Responses:

    • During passage through the gastrointestinal tract, Y. pseudotuberculosis faces pH changes

    • Proton-pumping functions of the respiratory chain may contribute to pH homeostasis

    • nuoK's role in proton translocation might be particularly important under acidic conditions

  • Nutrient Availability Adaptation:

    • Different environments offer different carbon and energy sources

    • The respiratory chain needs to accommodate various electron donors depending on available nutrients

    • nuoK function may be integrated with global metabolic responses to nutrient shifts

  • Research Design for Environmental Adaptation Studies:

Environmental ConditionExperimental ApproachParameters to MeasureExpected Role of nuoK
Oxygen LimitationGrowth in microaerobic conditionsGrowth rate, ATP productionCritical for energy conservation
Temperature ShiftsGrowth at 4°C vs. 37°CMembrane fluidity, respiratory efficiencyAdaptation to membrane changes
Acidic EnvironmentGrowth at pH 4.5-6.5Internal pH maintenance, survivalContributing to PMF and pH homeostasis
Nutrient LimitationMinimal media with various carbon sourcesMetabolic pathway utilizationSupporting respiratory flexibility
  • Connection to Virulence Regulation:

    • Environmental sensing mechanisms often control virulence gene expression

    • The respiratory chain status may serve as a proxy for environmental conditions

    • nuoK function could indirectly influence virulence factor expression through effects on cellular energetics

Such environmental adaptation capabilities are critical for Y. pseudotuberculosis, which must transition from environmental reservoirs to mammalian hosts, similar to how it has been shown to adapt to various tissues during infection progression .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.