Recombinant Yersinia pseudotuberculosis serotype IB Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF (arnF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
arnF; YPTS_2399; Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; L-Ara4N-phosphoundecaprenol flippase subunit ArnF; Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-128
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
arnF
Target Protein Sequence
MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYFVQLASVMCGLMGYAL SMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATLLKTLGAGFILLGIWLI NIKPIKAS
Uniprot No.

Target Background

Function

This protein functions as a probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit. It translocates 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol (α-L-Ara4N-phosphoundecaprenol) across the inner membrane, from the cytoplasmic to the periplasmic side.

Database Links
Protein Families
ArnF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of ArnF in Yersinia pseudotuberculosis?

ArnF functions as a subunit of a flippase involved in transporting 4-amino-4-deoxy-L-arabinose (Ara4N) across the inner membrane. Based on structural similarities to the ArnF protein in Y. pestis, it likely participates in the modification of lipopolysaccharide (LPS) with Ara4N, contributing to resistance against cationic antimicrobial peptides .

Methodologically, researchers investigating ArnF function should employ gene knockout studies followed by antimicrobial susceptibility testing. Complementation assays with wild-type and mutant genes can further confirm specific roles and identify key functional residues. Mass spectrometry analysis of lipid A can verify the absence of Ara4N modifications in arnF mutants.

How does ArnF structure in Y. pseudotuberculosis compare to that in Y. pestis?

While Y. pseudotuberculosis and Y. pestis are closely related species, their ArnF proteins may exhibit subtle structural differences. The computed structure model of ArnF from Y. pestis Angola shows high confidence (pLDDT global score: 92.65), suggesting a well-defined structure .

To investigate structural differences, researchers should:

  • Perform sequence alignments between ArnF proteins from both species

  • Use structure prediction tools like AlphaFold for comparative analysis

  • Validate predictions through experimental approaches such as X-ray crystallography or cryo-EM

  • Conduct functional studies to determine if structural differences correlate with functional divergence

Y. pseudotuberculosis has six sRNAs that are absent from Y. pestis, suggesting evolutionary changes in post-transcriptional regulation between these species , which might also impact ArnF expression and function.

What methods are recommended for expressing recombinant ArnF protein?

Expressing membrane proteins like ArnF presents unique challenges requiring specialized approaches:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)Common for bacterial proteinsMay be toxic; consider derivatives like C41/C43
Cell-free systemsAvoids toxicity issuesHigher cost, potentially lower yield
Yeast systemsBetter for eukaryotic-like foldingGlycosylation may differ from bacterial patterns

For optimal expression:

  • Use expression vectors with controllable promoters (T7, arabinose-inducible)

  • Add purification tags (His, GST, MBP) to facilitate purification

  • Express at lower temperatures (16-20°C) with reduced inducer concentrations

  • Screen multiple detergents (DDM, LDAO, etc.) for solubilization

  • Consider fusion partners that enhance solubility and folding

What role does ArnF play in antimicrobial resistance?

ArnF contributes to antimicrobial resistance by facilitating LPS modification with Ara4N, which reduces the negative charge of the bacterial outer membrane, making it less susceptible to cationic antimicrobial peptides.

To investigate this role experimentally:

  • Generate arnF knockout mutants and assess susceptibility to various antimicrobial peptides

  • Perform lipid A analysis by mass spectrometry to confirm the absence of Ara4N modifications

  • Conduct complementation studies with wild-type and mutant versions of arnF

  • Investigate arnF expression under different stress conditions (antimicrobial exposure, low Mg²⁺, acidic pH)

How does ArnF expression change under different environmental conditions?

The expression of genes involved in antimicrobial resistance often responds to environmental cues. For investigating ArnF expression patterns:

TechniqueApplicationAdvantages
qRT-PCRMeasure mRNA levelsSensitive, quantitative
RNA-seqGlobal transcriptomic analysisIdentifies co-regulated genes
Reporter gene fusionsVisualize expression in real-timeSingle-cell resolution
Western blottingQuantify protein levelsDirectly measures protein abundance
ProteomicsGlobal protein abundanceUnbiased approach

A particularly relevant approach would be comparing expression at 26°C versus 37°C, as Y. pseudotuberculosis experiences temperature shifts during host invasion, and other virulence factors show temperature-dependent expression .

What are the challenges in purifying functionally active recombinant ArnF?

Purifying membrane proteins like ArnF in a functionally active form presents several challenges:

  • Solubilization: Finding detergents that effectively solubilize ArnF without denaturing it

  • Stability: Maintaining stability during purification steps

  • Functional assessment: Developing assays to confirm retained flippase activity

  • Reconstitution: For functional studies, ArnF may need reconstitution into liposomes

  • Homogeneity: Achieving preparations suitable for structural studies

A systematic approach involves screening multiple detergents, optimizing buffer conditions, and using techniques like size exclusion chromatography to assess protein homogeneity. Additionally, researchers should consider stabilizing agents and preserving any necessary co-factors for activity.

How does ArnF interact with the host immune system during infection?

The interaction between ArnF and the host immune system is likely indirect, through its role in modifying LPS. To investigate this relationship:

  • In vitro studies: Expose wild-type and arnF-deficient Y. pseudotuberculosis to immune cells (macrophages, neutrophils) and assess differences in cytokine production, phagocytosis, and killing

  • Mouse infection models: Compare virulence of wild-type and arnF-deficient strains in different mouse genetic backgrounds

  • LPS recognition analysis: Investigate how LPS modifications affect recognition by pattern recognition receptors like TLR4

  • Antimicrobial peptide resistance: Test susceptibility to host-derived antimicrobial peptides

Y. pseudotuberculosis employs various strategies to evade immune responses, including suppression of phagocytic activity through Type III secretion system effectors and chromosome-encoded toxins . Understanding how ArnF contributes to this immune evasion provides valuable insights into pathogenesis.

What techniques can be used to study the flippase activity of ArnF?

Investigating the flippase activity of ArnF requires specialized techniques:

TechniqueDescriptionData Output
Liposome reconstitutionReconstitute purified ArnF into liposomes with fluorescently labeled lipid analogsTransport rates across membranes
Transport assaysMeasure translocation of Ara4N-phosphoundecaprenol or analogsSubstrate specificity and kinetics
ATPase activity assaysMeasure ATP hydrolysis rates if ArnF is ATP-dependentEnzymatic activity parameters
Fluorescence approachesUse environment-sensitive fluorophores to detect lipid flippingReal-time monitoring of activity
Mass spectrometryAnalyze lipid composition on either side of the membraneDirect substrate identification
Cryo-EM/X-ray crystallographyCapture different conformational states during transportStructural insights into mechanism

How can targeted mutations in arnF reveal structure-function relationships?

To investigate structure-function relationships in ArnF, researchers can employ:

  • Site-directed mutagenesis: Based on sequence analysis and structural models , mutate conserved residues or those predicted to be involved in transport

  • Alanine-scanning mutagenesis: Systematically replace residues with alanine to identify essential regions

  • Domain swapping: Exchange domains between ArnF proteins from different species to identify species-specific functions

  • Truncation analysis: Create truncated versions to identify minimal functional units

  • Random mutagenesis: Use error-prone PCR followed by selection for altered phenotypes

  • Functional complementation: Test mutants for their ability to restore wild-type phenotypes in arnF-deficient strains

Each mutant should be assessed for expression, localization, and functional activity to establish comprehensive structure-function relationships.

What role might small RNAs play in regulating ArnF expression?

Small RNAs (sRNAs) are important post-transcriptional regulators in bacteria. In Y. pseudotuberculosis, 150 unannotated sRNAs have been identified , which could potentially regulate ArnF expression. To investigate this:

  • In silico prediction: Use bioinformatic tools to predict sRNA-mRNA interactions involving the arnF transcript

  • RNA-RNA interaction validation: Use techniques like EMSA or SHAPE to validate predicted interactions

  • Gene expression analysis: Compare arnF expression levels in wild-type and sRNA deletion strains

  • Reporter gene assays: Create fusions of the arnF 5' UTR with reporter genes to assess sRNA impact on translation

  • RNA stability assays: Determine if sRNAs affect arnF mRNA stability

Since Hfq (an sRNA chaperone) is required for Y. pseudotuberculosis virulence , investigating whether arnF is regulated by Hfq-dependent sRNAs would be particularly informative.

How should researchers design experiments to study ArnF function in virulence?

To understand how ArnF contributes to Y. pseudotuberculosis virulence, researchers should design experiments that:

  • Create arnF deletion mutants and test virulence in animal models (similar to approaches used for studying sRNAs )

  • Analyze tissue colonization and dissemination patterns of wild-type versus arnF-deficient strains

  • Investigate survival in phagocytes, considering Y. pseudotuberculosis expresses proteins that suppress phagocytic activity

  • Study resistance to host antimicrobial peptides in various tissues

  • Perform competitive index experiments with mixed infections of wild-type and mutant strains

  • Analyze immune response markers during infection with wild-type versus arnF-deficient strains

Functional data analysis (FDA) approaches can be beneficial for analyzing complex datasets from infection experiments, as they handle continuously measured data more effectively than traditional methods .

What bioinformatic approaches can predict ArnF interaction partners?

Identifying protein-protein interactions is crucial for understanding ArnF function. Bioinformatic approaches include:

ApproachDescriptionApplication to ArnF
Co-expression analysisIdentify genes with correlated expression patternsFind genes co-regulated with arnF
Genomic context analysisExamine conservation of gene neighborhoodsIdentify functionally related genes
Protein-protein interaction predictionUse algorithms based on sequence/structurePredict direct interaction partners
Structural modelingUse AlphaFold models to predict interaction surfacesIdentify potential binding sites
Homology-based inferenceIdentify interaction partners of ArnF homologsLeverage known interactions in related proteins

Experimental validation of predicted interactions would be necessary using techniques like bacterial two-hybrid assays, co-immunoprecipitation, or cross-linking coupled with mass spectrometry.

How can researchers address data contradictions in ArnF functional studies?

When encountering contradictory results in ArnF research:

  • Strain differences: Verify if different Y. pseudotuberculosis strains were used, as strain-specific variations might exist

  • Experimental conditions: Compare growth conditions, temperatures, and media composition

  • Methodology validation: Ensure knockout mutants are properly verified and complementation constructs express functional protein

  • Technical replication: Increase the number of technical and biological replicates to improve statistical power

  • Alternative approaches: Apply orthogonal methods to verify findings

  • Meta-analysis: Systematically review and analyze all available data using statistical approaches

Contradictions might reflect genuine biological complexity rather than experimental error, potentially revealing condition-specific functions of ArnF.

What emerging technologies could advance ArnF research?

Several cutting-edge technologies hold promise for advancing ArnF research:

  • CRISPR-Cas9 genome editing: Create precise mutations in arnF with minimal off-target effects

  • Single-cell RNA-seq: Analyze heterogeneity in arnF expression within bacterial populations

  • Cryo-electron tomography: Visualize ArnF in its native membrane environment

  • Nanobody technology: Develop specific probes for tracking ArnF localization and dynamics

  • High-throughput antimicrobial screening: Identify compounds that specifically target ArnF function

  • Isotope-encoded crosslinking mass spectrometry: Map ArnF interaction networks with high precision

  • Microfluidics: Study real-time responses of arnF expression to changing environmental conditions

How might comparative studies between Y. pseudotuberculosis and Y. pestis advance understanding of ArnF?

Comparative studies between these closely related species can provide valuable insights:

  • Compare the structural and functional properties of ArnF between Y. pseudotuberculosis and Y. pestis

  • Investigate whether the six Y. pseudotuberculosis-specific sRNAs impact ArnF expression or function

  • Examine differences in ArnF regulation between the species, particularly the timing and dependence on Hfq

  • Study how ArnF contributes to the distinct pathogenic strategies of these species

  • Investigate whether the evolutionary changes in post-transcriptional regulation between these species affect ArnF function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.