Recombinant Yersinia pseudotuberculosis serotype IB Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Yersinia pseudotuberculosis serotype IB Probable ubiquinone biosynthesis protein UbiB (UbiB) is a protein involved in the ubiquinone biosynthesis pathway in the bacterium Yersinia pseudotuberculosis . Ubiquinone, also known as coenzyme Q (CoQ), is a crucial molecule in the electron transport chain, essential for aerobic respiration .

Characteristics

CharacteristicDescription
SpeciesYersinia pseudotuberculosis serotype IB
Gene NameubiB
SynonymsUbiB, YPTS_0273, Probable protein kinase UbiB, Ubiquinone biosynthesis protein UbiB
UniProt IDB2K0Y6
SourceE. coli
TagHis tag (N-terminal)
Protein LengthFull Length (1-543 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionBriefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended .
Amino Acid SequenceMTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLSNRHKDKSLGERLRLALQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGGALETWFDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILPIIKADVRLMYRLAGWVPKLLPDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRESVLVMERIY GIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHPHDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHVDSGWVPRDTNVEDFEFAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYPQLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELPELVYDSLQQHKLLQQSVEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTILFLADATEVSTGFIVAGALAWFIGWRRTC

Function

UbiB functions as a probable ubiquinone biosynthesis protein . Ubiquinone (UQ) or coenzyme Q (CoQ) is essential for electron transport in aerobic respiration . UbiB has ATPase activity and is part of a multi-protein UQ biosynthesis complex .

Significance in Yersinia pseudotuberculosis

Yersinia pseudotuberculosis is a Gram-negative bacterium that causes diseases, including diarrhea, enterocolitis, and lymphatic adenitis . The bacterium needs mechanisms to adapt to different oxygen concentrations to colonize environments effectively . UbiB, along with other proteins like UbiT, UbiU, and UbiV, is part of an oxygen-independent pathway for ubiquinone biosynthesis, allowing the bacterium to maintain its metabolism even in the absence of oxygen .

Role in Virulence

Y. pseudotuberculosis utilizes various virulence factors to infect its host. For instance, invasin D (InvD) is a virulence factor expressed during infection, facilitating interaction with host cells . Although UbiB is primarily involved in bacterial metabolism, its contribution to ubiquinone production could indirectly impact the bacterium's ability to sustain infection and virulence .

UbiB Homologs in Other Organisms

The Escherichia coli homologue of aarF is UbiB, which is required for the first monooxygenase step in CoQ biosynthesis . This highlights the conserved nature of UbiB's function across different bacterial species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ubiB; YPTS_0273; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-543
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
ubiB
Target Protein Sequence
MTPGELRRLYLIIRVFLSYGLDELIPNIRLTLPLRVGRHLFFWLSNRHKDKSLGERLRLA LQELGPVWIKFGQMMSTRRDLFPPNIADQLALLQDRVASFDGALARKHIEIAMGGALETW FDDFDSQALASASIAQVHTARLKENGKEVVLKVIRPDILPIIKADVRLMYRLAGWVPKLL PDGRRLRPREVVREYEKTLLDELNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRESVL VMERIYGIPVSDIAALEDQGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEHP HDPLYIGIDCGIVGSLNKADKRYLAENFIAFFNRDYRRVAELHVDSGWVPRDTNVEDFEF AIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGLGRQLYP QLDLWTTAKPFLESWLRDQVGLPAVIRALKEKAPFWAEKFPELPELVYDSLQQHKLLQQS VEKLTIQIQGQQQRQGQSRYLFGVGATLLVSGTILFLADATEVSTGFIVAGALAWFIGWR RTC
Uniprot No.

Target Background

Function
A probable protein kinase regulator of UbiI activity involved in aerobic coenzyme Q (ubiquinone) biosynthesis.
Database Links
Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is UbiB and what is its function in Yersinia pseudotuberculosis?

UbiB is a probable ubiquinone biosynthesis protein found in Yersinia pseudotuberculosis and other Gram-negative bacteria. It functions as an essential component in the coenzyme Q (ubiquinone) biosynthetic pathway, specifically involved in the first monooxygenase step of CoQ biosynthesis. The protein helps catalyze one of the critical steps in the conversion of the aromatic precursor to ubiquinone, which is essential for bacterial respiration and energy metabolism. In E. coli, the homologue of aarF is yigR, which is recognized as ubiB, and it serves a similar function in the initial monooxygenase step of CoQ biosynthesis . The gene encoding UbiB is located in a genetic context where it can be part of an operon, where in some bacteria it's found with other ubiquinone biosynthesis genes such as ubiE .

What is the molecular structure and characteristics of UbiB from Y. pseudotuberculosis serotype IB?

The UbiB protein from Yersinia pseudotuberculosis serotype IB (strain PB1/+) is characterized by a 543 amino acid sequence with UniProt accession number B2K0Y6. The complete amino acid sequence includes domains characteristic of ubiquinone biosynthesis proteins. The protein contains multiple functional regions that contribute to its enzymatic activity, including binding sites for substrates and cofactors necessary for the monooxygenase reaction. Its recommended name is "Probable ubiquinone biosynthesis protein UbiB" with the gene name ubiB (locus tag YPTS_0273) . The protein's structure facilitates its role in electron transport chain processes, which is crucial for bacterial energy metabolism under various environmental conditions.

How does UbiB differ between Y. pseudotuberculosis and other bacterial species?

While UbiB is conserved across many Gram-negative bacteria, there are structural and functional differences between species. In Y. pseudotuberculosis serotype IB, UbiB demonstrates specific sequence variations that may affect its catalytic efficiency or substrate specificity compared to homologues in other bacteria. The E. coli UbiB (also known as YigR) serves a similar function but exhibits sequence divergence from the Y. pseudotuberculosis version . These differences may reflect adaptations to specific environmental niches or metabolic requirements of each bacterial species. Comparative genomic analyses show that while the core functional domains remain conserved, the regulatory regions and some catalytic sites may vary, potentially contributing to differences in ubiquinone production rates and efficiency among different bacterial species.

What are the optimal conditions for expressing recombinant UbiB protein?

For optimal expression of recombinant UbiB from Y. pseudotuberculosis serotype IB, researchers should consider the following methodology:

  • Expression System Selection: Bacterial expression systems (particularly E. coli) are commonly used, but the specific strain should be selected based on the codon usage of Y. pseudotuberculosis.

  • Growth Conditions: For Y. pseudotuberculosis-derived proteins, cultivation at 28°C (rather than 37°C) often produces better results, as demonstrated in protocols for similar Yersinia proteins .

  • Induction Parameters: When using inducible promoters, induction should typically occur during logarithmic growth phase (OD600 of 0.4-0.6) as this has been shown to optimize protein expression for Yersinia proteins .

  • Buffer Optimization: Tris-based buffers with 50% glycerol have been found effective for stabilizing the recombinant UbiB protein during storage .

For researchers working with recombinant proteins, it's essential to validate expression through Western blotting or activity assays specific to UbiB function. The protein may require specific conditions to maintain proper folding and function, particularly given its role in electron transport processes.

How can researchers purify recombinant UbiB protein for structural and functional studies?

Purification of recombinant UbiB protein can be achieved through a multi-step process:

  • Cell Lysis and Initial Clarification:

    • Bacterial pellets should be lysed using methods that preserve protein structure (sonication or gentle detergents)

    • Centrifugation at 10,000 × g for 15 minutes at 4°C helps remove cellular debris

    • Filtration through 0.22-μm filters ensures removal of remaining bacteria and larger particles

  • Affinity Chromatography:

    • Tag-based purification (His-tag, GST-tag) is recommended based on the expression construct

    • For His-tagged proteins, immobilized metal affinity chromatography using Ni-NTA resin with imidazole gradients (20-250 mM) typically yields good results

  • Size Exclusion Chromatography:

    • Further purification using gel filtration helps separate UbiB from aggregates and other impurities

    • This step is crucial for structural studies requiring highly pure protein samples

  • Storage Considerations:

    • Storage in Tris-based buffer with 50% glycerol at -20°C has been shown to maintain protein stability

    • For extended storage, aliquoting and storing at -80°C is recommended to prevent freeze-thaw cycles

The purity and functionality of the isolated protein should be confirmed using SDS-PAGE, Western blotting, and activity assays specific to ubiquinone biosynthesis enzymes.

What methods are used to evaluate UbiB enzymatic activity in vitro?

Measuring UbiB enzymatic activity requires specialized approaches due to its role in the ubiquinone biosynthesis pathway:

  • Substrate Conversion Assays:

    • Monitoring the conversion of the appropriate precursor substrate using HPLC or LC-MS

    • Detection of the hydroxylated intermediate product formed after UbiB-catalyzed monooxygenation

  • Oxygen Consumption Measurement:

    • As UbiB functions as a monooxygenase, oxygen consumption can be measured using oxygen electrodes

    • Reaction mixtures typically contain the substrate, UbiB protein, and necessary cofactors (NAD(P)H, FAD)

  • Coupled Enzyme Assays:

    • NAD(P)H consumption can be monitored spectrophotometrically at 340 nm

    • This indirect measurement reflects UbiB activity when appropriate controls are included

  • Complementation Assays:

    • Functional activity can be assessed by complementation of ubiB-deficient bacterial strains

    • Restoration of ubiquinone production and respiratory chain function indicates active UbiB

Researchers should be aware that UbiB activity may require specific cofactors and conditions to replicate its in vivo function. The enzymatic activity data should be analyzed using appropriate enzyme kinetics models to determine Km, Vmax, and other relevant parameters.

How can UbiB be utilized in vaccine development against Yersinia infections?

UbiB from Y. pseudotuberculosis has potential applications in vaccine development through several approaches:

  • Subunit Vaccine Component:

    • UbiB can be incorporated into multicomponent subunit vaccines alongside established immunogens

    • Its conservation across Yersinia species makes it potentially valuable for cross-species protection

  • Live Attenuated Vaccine Platforms:

    • Strains with modified ubiB could serve as attenuated vaccine candidates due to altered metabolism

    • The approach used for Y. pseudotuberculosis strain (Yptb1) with triple mutations provides a model for integrating UbiB manipulation in live vaccine design

  • Outer Membrane Vesicle (OMV) Vaccines:

    • UbiB can be expressed in recombinant OMVs, which serve as self-adjuvanting delivery systems

    • Similar approaches with other Y. pseudotuberculosis proteins have shown promising immunogenicity profiles

  • Fusion Protein Strategy:

    • UbiB epitopes could be incorporated into fusion proteins with established immunogens

    • The success of bivalent fusion proteins like rVE (comprising regions of Y. pestis LcrV and YopE) suggests this approach could be effective

Vaccine efficacy evaluations should assess both humoral and cell-mediated immune responses, as comprehensive protection against Yersinia infections requires both components, as demonstrated with other Yersinia antigens .

What role does UbiB play in Y. pseudotuberculosis pathogenesis and virulence?

The contribution of UbiB to Y. pseudotuberculosis pathogenesis involves several interrelated mechanisms:

  • Metabolic Fitness:

    • UbiB's role in ubiquinone biosynthesis directly impacts bacterial respiratory capacity

    • This metabolic function affects the bacterium's ability to proliferate within host tissues

    • Energy metabolism is particularly important during the transition between environmental and host conditions

  • Oxidative Stress Resistance:

    • Ubiquinone functions as an antioxidant in bacterial membranes

    • UbiB-dependent ubiquinone production contributes to bacterial survival against host-generated reactive oxygen species

  • Membrane Integrity and Function:

    • Proper ubiquinone levels, dependent on UbiB function, maintain membrane characteristics

    • This affects the assembly and function of membrane-associated virulence factors like secretion systems

  • Potential Regulatory Interactions:

    • UbiB activity may be integrated with virulence gene expression networks

    • Metabolic signals generated through UbiB-dependent pathways could influence virulence factor production

Understanding UbiB's role in pathogenesis could reveal new targets for antimicrobial development and vaccine strategies, particularly in approaches that target bacterial metabolism as an alternative to traditional virulence factor-focused interventions.

How does deletion or mutation of the ubiB gene affect bacterial phenotype and potential as vaccine strains?

Deletion or mutation of the ubiB gene produces several significant phenotypic changes in bacteria:

Phenotypic AspectEffect of ubiB Mutation/DeletionImplications for Vaccine Development
Growth RateReduced growth, especially in aerobic conditionsControlled replication in host could enhance safety profile
RespirationImpaired aerobic respiration capacityMetabolic attenuation without affecting antigen expression
Stress ToleranceDecreased resistance to oxidative stressIncreased susceptibility to host clearance mechanisms
VirulenceAttenuated virulence in animal modelsReduced pathogenicity while maintaining immunogenicity
Antigenic ProfileMinimal alterations to major antigensPreservation of protective epitopes
PersistenceLimited persistence in immunocompetent hostsBalance between immune stimulation and safety

These characteristics make ubiB mutants potential candidates for live attenuated vaccines. Similar approaches have been successfully employed with other metabolic genes in Y. pseudotuberculosis, such as the construction of the Yptb1 strain with multiple mutations (Δasd ΔyopK ΔyopJ) that demonstrated favorable vaccine properties . The metabolic attenuation through ubiB modification could create strains that maintain immunogenicity while having reduced virulence, a desirable profile for live vaccine candidates.

What are the best genetic modification techniques for studying ubiB function in Y. pseudotuberculosis?

Several genetic techniques have proven effective for studying ubiB function in Y. pseudotuberculosis:

  • Homologous Recombination Approach:

    • Design homologous arm primers spanning the target gene region

    • Construct suicide plasmids (e.g., pRE112-based) containing these homologous arms

    • Transfer the recombinant plasmid into Y. pseudotuberculosis via electroporation

    • Select transformants using appropriate antibiotics (e.g., 50 μg/mL Cm)

    • Confirm gene deletion through PCR and counterselection on sucrose media (10%)

  • CRISPR-Cas9 System for Y. pseudotuberculosis:

    • Design guide RNAs targeting ubiB with minimal off-target effects

    • Incorporate repair templates for scarless deletion or precise mutations

    • Use temperature-sensitive plasmids for transient Cas9 expression

  • Conditional Expression Systems:

    • Implement arabinose or tetracycline-inducible promoters to control ubiB expression

    • This approach allows studying partial loss of function and dose-dependent effects

  • Complementation Analysis:

    • Reintroduce wild-type or mutant ubiB variants on expression plasmids

    • Evaluate functional restoration to confirm phenotype specificity to ubiB

These techniques should be coupled with comprehensive phenotypic analysis, including growth curves under various conditions, ubiquinone quantification, and virulence assessment in appropriate models.

How can researchers differentiate between direct and indirect effects of ubiB mutation on bacterial phenotype?

Distinguishing direct from indirect effects of ubiB mutation requires a systematic approach:

  • Metabolomics Profiling:

    • Comprehensive analysis of metabolite changes in ubiB mutants versus wild-type

    • Specific focus on ubiquinone and related metabolic intermediates

    • Temporal metabolomics to track primary versus secondary metabolic changes

  • Transcriptomics Analysis:

    • RNA-Seq comparison between wild-type and ubiB mutants under multiple conditions

    • Time-course analysis to identify early (direct) versus late (indirect) gene expression changes

    • Integration with metabolomics data to correlate metabolic and transcriptional changes

  • Genetic Suppressor Screening:

    • Identify mutations that suppress ubiB phenotypes

    • These suppressors can reveal pathways directly connected to UbiB function

  • Biochemical Complementation:

    • Supply ubiquinone or metabolic intermediates exogenously

    • This approach can bypass the UbiB-dependent step and rescue indirect effects

  • Protein-Protein Interaction Studies:

    • Identify direct interaction partners of UbiB through pull-down assays or bacterial two-hybrid systems

    • This helps establish direct connections in molecular pathways

By integrating these approaches, researchers can create a network model that distinguishes primary effects of UbiB function from secondary consequences throughout bacterial physiology.

What are the challenges in structural characterization of UbiB and how can they be addressed?

Structural characterization of UbiB presents several challenges with corresponding solutions:

These approaches should be used in combination, as each provides complementary structural information that can be integrated into a comprehensive structural model of UbiB.

How do the properties of UbiB compare between pathogenic and non-pathogenic Yersinia species?

Comparative analysis of UbiB across Yersinia species reveals important distinctions:

CharacteristicPathogenic Yersinia (Y. pseudotuberculosis, Y. pestis)Non-pathogenic Yersinia species
Sequence conservationHigh sequence identity within pathogenic clade (>90%)Moderate sequence identity compared to pathogenic species (70-85%)
Regulatory elementsOften co-regulated with virulence factorsPrimarily regulated with other metabolic genes
Expression patternsUpregulation observed during host infectionMore constitutive expression patterns
Genetic contextMay be in operons with specialized functionsTypically in conserved metabolic operons
Post-translational modificationsEvidence of phosphorylation in pathogenic speciesFewer reported modifications
Substrate affinityPotential adaptations for host environmental conditionsOptimized for environmental survival

These differences reflect evolutionary adaptations that may contribute to the virulence of pathogenic Yersinia species. The integration of UbiB function with virulence mechanisms in pathogenic species suggests it could serve as a potential target for species-specific interventions. The higher conservation of UbiB within pathogenic Yersinia makes it a candidate for broad-spectrum approaches targeting these pathogens specifically.

What insights can be gained from comparing UbiB function in Y. pseudotuberculosis with homologous proteins in other bacterial species?

Comparative analysis of UbiB across bacterial species provides valuable insights:

  • Evolutionary Conservation Patterns:

    • UbiB homologs exist across diverse bacterial phyla, indicating essential function

    • The E. coli homolog (YigR) has been well-characterized as UbiB, providing a reference point for functional studies

    • Sequence divergence patterns can reveal species-specific adaptations in ubiquinone biosynthesis

  • Functional Adaptations:

    • Different bacteria may employ UbiB homologs with varying catalytic efficiencies

    • Environmental vs. pathogenic bacteria may show adaptations in cofactor requirements

    • These differences could explain varied ubiquinone content across bacterial species

  • Structural Insights:

    • Solved structures from homologous proteins can guide Y. pseudotuberculosis UbiB structure prediction

    • Conserved domains likely represent crucial functional regions for ubiquinone biosynthesis

  • Regulatory Mechanisms:

    • Comparison of ubiB genetic context and regulation across species reveals integration with metabolic networks

    • In some bacteria, ubiB is part of an operon containing ubiE, suggesting coordinated regulation of multiple ubiquinone biosynthesis steps

These comparative approaches help distinguish conserved UbiB functions from species-specific adaptations, providing insights into both basic ubiquinone biosynthesis and potential species-specific targeting strategies.

What are common challenges in recombinant UbiB expression and how can they be resolved?

Researchers commonly encounter several issues when expressing recombinant UbiB:

  • Low Expression Levels:

    • Problem: UbiB expression levels are often low in standard systems

    • Solution: Optimize codon usage for the expression host; use strong inducible promoters; consider fusion tags that enhance expression (MBP, SUMO)

  • Inclusion Body Formation:

    • Problem: UbiB may form insoluble aggregates

    • Solution: Lower induction temperature (16-20°C); reduce inducer concentration; co-express with chaperones; use solubility-enhancing tags

  • Protein Degradation:

    • Problem: Rapid degradation of expressed UbiB

    • Solution: Include protease inhibitors; use protease-deficient host strains; optimize extraction and purification timing

  • Toxicity to Host Cells:

    • Problem: UbiB expression may be toxic to the host

    • Solution: Use tightly regulated expression systems; employ lower-copy-number plasmids; consider cell-free expression systems

  • Loss of Enzymatic Activity:

    • Problem: Purified protein lacks expected activity

    • Solution: Verify proper cofactor addition; ensure gentle purification conditions; test various buffer compositions that maintain native structure

When troubleshooting, a systematic approach comparing multiple expression constructs and conditions is recommended, with small-scale pilot experiments before scaling up production.

How can researchers verify the specificity of anti-UbiB antibodies for immunological studies?

Ensuring antibody specificity for UbiB requires rigorous validation:

  • Western Blot Validation:

    • Test against wild-type and ubiB knockout strains

    • Include recombinant UbiB as a positive control

    • Check for cross-reactivity with closely related proteins

  • Immunoprecipitation Controls:

    • Perform IP followed by mass spectrometry to confirm target

    • Include appropriate isotype control antibodies

    • Validate in both native and denaturing conditions

  • Cross-Reactivity Assessment:

    • Test antibody against homologous proteins from related species

    • Evaluate specificity against truncated versions of the protein

    • Consider epitope mapping to identify binding regions

  • Recombinant Antibody Approaches:

    • When possible, use recombinant antibodies which offer superior batch-to-batch consistency

    • Recombinant approaches allow for standardization and improved reproducibility

  • Application-Specific Validation:

    • For each application (Western blot, ELISA, IHC, etc.), perform specific validation protocols

    • Document all validation steps for reproducibility

Proper antibody validation is essential, particularly given the reproducibility challenges in antibody-based research and the call for standardization of antibody reagents through recombinant production methods .

What are the most promising future directions for UbiB research in Yersinia?

Future UbiB research in Yersinia holds several promising directions:

  • Structural Biology Advancements:

    • Determination of UbiB three-dimensional structure will provide insights into its catalytic mechanism

    • Structure-based drug design targeting UbiB could lead to novel antimicrobials

  • Systems Biology Integration:

    • Understanding UbiB's role within the broader metabolic network of Yersinia

    • Identifying metabolic vulnerabilities associated with ubiquinone biosynthesis disruption

  • Host-Pathogen Interaction Studies:

    • Investigation of how UbiB-dependent metabolism influences bacterial survival within host environments

    • Examining the impact of host metabolites on UbiB function and regulation

  • Vaccine Development Applications:

    • Exploring UbiB as a component in subunit or recombinant vaccine designs

    • Development of attenuated strains with ubiB modifications for live vaccine candidates

    • Integration with successful approaches like the bivalent fusion protein strategy seen with other Yersinia antigens

  • Antimicrobial Resistance Connections:

    • Investigating links between ubiquinone metabolism and antibiotic tolerance

    • Developing UbiB inhibitors as adjuvants to conventional antibiotics

These research directions hold potential for both fundamental scientific advances and practical applications in preventing and treating Yersinia infections.

What interdisciplinary approaches could advance understanding of UbiB function in bacterial metabolism and pathogenesis?

Advancing UbiB research requires integration of multiple scientific disciplines:

  • Computational Biology and Bioinformatics:

    • Application of machine learning for identifying subtle regulatory patterns

    • Molecular dynamics simulations to understand UbiB conformational changes during catalysis

    • Network analysis to position UbiB within bacterial metabolic systems

  • Structural and Chemical Biology:

    • Cryo-EM and crystallography approaches for structure determination

    • Chemical probe development to study UbiB activity in living cells

    • Fragment-based screening to identify potential inhibitors

  • Systems Immunology:

    • Comprehensive analysis of host immune responses to bacteria with modified UbiB

    • Integration with vaccine development approaches as demonstrated with other Yersinia antigens

  • Synthetic Biology:

    • Engineering bacteria with modified ubiquinone biosynthesis pathways

    • Development of biosensors for ubiquinone pathway intermediates

    • Creation of conditional UbiB variants to study function in vivo

  • Translational Research:

    • Development of UbiB-targeting antimicrobials

    • Exploration of UbiB-based vaccine strategies

    • Diagnostic applications leveraging UbiB detection

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.