Recombinant Yersinia pseudotuberculosis serotype IB Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Introduction to Lgt and Its Biological Significance

Prolipoprotein diacylglyceryl transferase (Lgt) is a conserved enzyme in Gram-negative bacteria responsible for the first step in lipoprotein biogenesis. It catalyzes the transfer of a diacylglyceryl group from phosphatidylglycerol to the thiol group of the conserved cysteine residue (+1 position) in prolipoproteins, enabling membrane anchoring and functional maturation of lipoproteins . In Yersinia pseudotuberculosis serotype IB, Lgt is critical for synthesizing virulence-associated lipoproteins, such as those involved in Type III secretion systems (T3SSs) and pathogenesis .

The recombinant Lgt from Y. pseudotuberculosis serotype IB is a bioengineered protein expressed in heterologous systems (e.g., E. coli) for research and diagnostic applications. It retains structural and functional fidelity to the native enzyme, enabling studies on bacterial membrane biology, immune evasion mechanisms, and vaccine development .

Membrane Topology and Key Residues

Lgt is an inner membrane protein with seven transmembrane segments. Its N-terminus faces the periplasm, while the C-terminus is cytoplasmic . Critical residues identified in E. coli Lgt include:

  • Y26, N146, G154: Essential for catalytic activity.

  • R143, E151, R239, E243: Important for substrate binding and structural stability .
    In Y. pseudotuberculosis, these residues are conserved, suggesting a similar mechanism of action .

Biochemical Activity

Lgt transfers diacylglyceryl groups via a thioester intermediate. Inhibitors like G2824 disrupt this process, highlighting Lgt as a potential antibacterial target .

Role in Pathogenesis and Immune Evasion

Lipoproteins modified by Lgt are essential for bacterial survival and immune evasion. For example, Y. pseudotuberculosis uses T3SS effectors to suppress host phagocytic responses, which may depend on Lgt-modified lipoproteins .

Diagnostic and Vaccine Development

Recombinant Lgt is used in ELISA kits to detect antibodies against Y. pseudotuberculosis serotype IB . Its sequence (UniProt: A7FFD9 or B2JZ67) includes residues critical for antigenic recognition, making it a candidate for serotyping or subunit vaccines .

Outer Membrane Vesicle (OMV) Production

Engineered Y. pseudotuberculosis strains (e.g., ΔlpxL mutants) produce OMVs enriched with Lgt-modified lipoproteins. These OMVs are explored as adjuvants or vaccine platforms, particularly for Y. pestis LcrV antigen delivery .

Recombinant Lgt Products and Suppliers

SupplierProduct IDExpression SystemPurityApplications
MyBioSourceMBS7066652E. coli>90%ELISA, biochemical assays
Colorectal ResearchCSB-CF412327E. coli>95%ELISA, immunology studies
BiocheminfoMBS1000859E. coli>90%Structural studies

Key Findings from Functional Studies

  • Membrane Integrity: Lgt mutants accumulate unmodified prelipoproteins, impairing membrane stability and virulence .

  • Immune Response: Lgt-deficient strains induce weaker cytokine production (e.g., IL-6, IL-8), suggesting lipoproteins modulate host immune recognition .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
lgt; YPTS_3156; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-290
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
lgt
Target Protein Sequence
MSNSYLAFPKFDPVIFSIGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWTKEEVENL LYAGFLGVFIGGRVGYVLFYNLPMFLDNPLYLFKVWDGGMSFHGGLIGVICVMLWFARRT KRNFFQVADFIAPLIPFGLGAGRLGNFINAELWGRVTTDTPWAMLFPTSRNTDIAIVAAD PAKWQAIFNQYGVLPRHPSQLYEMILEGVVLFIILNVFIRKPRPMGSVSGLFLIGYGTFR IIVECFRQPDEQLGLFEGMISMGQILSVPMILAGIIMMIWAYRRPTQKLS
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, which is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis and how does it relate to Yersinia pestis?

Yersinia pseudotuberculosis is an enteric pathogen that shares a close evolutionary relationship with Yersinia pestis, the causative agent of plague. Y. pseudotuberculosis causes various clinical syndromes in humans and animals, and has been isolated from numerous wild and domesticated animals . Unlike Y. pestis, which is primarily transmitted through flea vectors and causes systemic plague, Y. pseudotuberculosis typically causes gastrointestinal infections. Both species harbor virulence plasmids of 70-75 kb, known as pYV, that encode critical virulence factors including adhesion/invasion proteins, antiphagocytic secreted proteins, and proteins involved in processing and secretion . Importantly, Y. pseudotuberculosis has been used as a model organism for understanding Y. pestis pathogenesis and for potential vaccine development against plague .

What is the function of lipoprotein diacylglyceryl transferase (lgt) in bacterial cells?

Lipoprotein diacylglyceryl transferase (lgt) is an integral membrane enzyme that catalyzes the first reaction in the three-step post-translational lipid modification pathway essential for bacterial lipoprotein biogenesis . Specifically, lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the conserved cysteine residue in the lipobox of prolipoprotein precursors. This post-translational modification is crucial for the proper localization and function of bacterial lipoproteins, which fulfill wide-ranging and vital biological functions including:

  • Maintenance of cell envelope architecture

  • Insertion and stabilization of outer membrane proteins

  • Nutrient uptake and transport

  • Adhesion, invasion, and virulence

The lgt gene is essential for survival in most Gram-negative bacteria, making it an attractive target for antimicrobial development.

What are the essential structural characteristics of lgt in bacterial membranes?

The crystal structure of Escherichia coli lgt, which shares significant homology with Y. pseudotuberculosis lgt, has been determined at high resolution (1.6-1.9 Å) . Key structural characteristics include:

  • Integral membrane protein with multiple transmembrane domains

  • Contains two distinct binding sites:

    • A phosphatidylglycerol binding site

    • A substrate/inhibitor binding site that accommodates the lipobox-containing peptide

  • Features critical catalytic residues, including Arg143 and Arg239, that are essential for diacylglyceryl transfer

  • Structural arrangement that allows substrate entry and product exit laterally relative to the lipid bilayer

This structural knowledge provides valuable insights into the mechanism of lgt and opportunities for structure-based drug design.

What are effective approaches for recombinant expression of Y. pseudotuberculosis lgt?

Recombinant expression of Y. pseudotuberculosis lgt requires careful optimization due to its membrane-associated nature. Successful expression strategies include:

  • Vector selection: Utilizing vectors with inducible promoters (e.g., pET or pBAD systems) that allow tight control of expression levels.

  • Host strain optimization: E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3), or BL21(DE3)pLysS) tend to yield better results than standard strains.

  • Expression conditions:

    • Lowering induction temperature (16-20°C)

    • Using lower inducer concentrations

    • Extending induction time (overnight)

    • Supplementing growth media with phospholipids

  • Fusion tags: Addition of tags that enhance solubility or facilitate purification, such as:

    • Histidine tags for metal affinity purification

    • MBP (maltose binding protein) or GST (glutathione S-transferase) for improved solubility

  • Membrane extraction: Employing gentle detergents (DDM, LDAO, or CHAPS) for efficient extraction while maintaining enzymatic activity.

For functional studies, it is critical to verify that the recombinant protein retains enzymatic activity through appropriate biochemical assays.

What animal models are appropriate for studying Y. pseudotuberculosis infections and evaluating lgt function?

Based on experimental evidence, the following animal models have been used successfully for Y. pseudotuberculosis research:

Animal ModelAdvantagesLimitationsKey Observations
Rabbits (New Zealand breed)Larger size allows for more sampling; good for immunological studiesHigher maintenance costs; require more spaceLoss of body weight, temperature rise, ruffling of fur observed upon infection
Guinea pigs (Abyssinian breed)Susceptible to infection; display clear symptomsModerate size; intermediate costSimilar clinical manifestations to rabbits
MiceCost-effective; genetically defined strains available; numerous immunological reagentsSmaller size limits some proceduresCommonly used for protective efficacy studies for potential vaccines

When designing infection studies:

  • Oral infection (10^8 CFU/ml) is a common route that mimics natural infection

  • Animals should be acclimatized to laboratory conditions (typically 9 days) before experiments

  • Baseline screening for Y. pseudotuberculosis antibodies should be performed to ensure animals are naive

  • Environmental conditions should be controlled (temperature 25±1°C, relative humidity ~50%)

  • All animal experiments must adhere to appropriate ethical guidelines

For specific lgt functional studies, knockout/complementation approaches are particularly valuable, with bacterial recovery from tissues serving as a key endpoint.

What are reliable methods for measuring lgt enzymatic activity in vitro?

Several validated methods exist for assessing lgt enzymatic activity:

  • Radiolabeled phospholipid incorporation assay:

    • Using [³H] or [¹⁴C]-labeled phosphatidylglycerol as the donor substrate

    • Monitoring transfer of the labeled diacylglyceryl group to a synthetic lipobox-containing peptide

    • Quantification by scintillation counting after lipid extraction

  • Fluorescence-based assays:

    • GFP-based in vitro assay that correlates lgt activity with structural observations

    • FRET-based assays using appropriately labeled substrates and products

  • Mass spectrometry-based approaches:

    • Direct detection of modified peptides using LC-MS/MS

    • Allows precise characterization of lipid modifications and enzyme specificity

  • Complementation assays:

    • Using lgt-knockout cells complemented with different mutant lgt variants

    • Critical for identifying essential residues like Arg143 and Arg239

When conducting these assays, appropriate controls are essential:

  • Reactions without enzyme (negative control)

  • Heat-inactivated enzyme controls

  • Reactions with known inhibitors (e.g., palmitic acid)

  • Reactions with well-characterized lgt mutants

How do mutations in critical lgt residues affect enzyme function and bacterial viability?

Structure-function studies of lgt have identified several critical residues essential for enzymatic activity. The table below summarizes key findings from mutagenesis studies:

ResidueMutationEffect on ActivityEffect on Bacterial ViabilityStructural Role
Arg143R143AAbolishedLethalEssential for diacylglyceryl transfer
Arg239R239ASeverely reducedLethalEssential for diacylglyceryl transfer
His103H103APartially reducedViable but attenuatedInvolved in substrate binding
Glu202E202AModerately reducedViable with growth defectsParticipates in catalytic mechanism
Tyr235Y235FMinimally affectedViableContributes to substrate specificity

These findings have been correlated with structural data, revealing that Arg143 and Arg239 play critical roles in orienting the phosphatidylglycerol substrate for nucleophilic attack by the cysteine thiol of the lipobox-containing peptide. Mutations in these residues prevent the complementation of lgt-knockout cells, highlighting their essential nature for enzyme function and bacterial survival .

What is the potential of Y. pseudotuberculosis lgt-derived outer membrane vesicles (OMVs) as vaccine candidates against Y. pestis?

Recent research has demonstrated significant promise for OMVs derived from remodeled Y. pseudotuberculosis strains as plague vaccine candidates. Key findings include:

  • Enhanced OMV production: Recombinant Y. pseudotuberculosis PB1+ strains designed to synthesize monophosphoryl lipid A (MPLA) and express Y. pestis LcrV antigen dramatically increased the production of OMVs containing high amounts of LcrV compared to Y. pestis counterparts .

  • Superior protection: Vaccination with these OMVs (designated as OMV YptbS44-Bla-V) provided superior protection compared to the F1V subunit vaccine or OMVs from recombinant Y. pestis strains:

    • Complete protection against medium dose (5×10³ CFU, 50 LD₅₀) pulmonary Y. pestis infection

    • Complete protection against high dose (400 LD₅₀) pulmonary infection

    • Complete protection against subcutaneous infection with 5×10⁵ CFU (50,000 LD₅₀) of Y. pestis

  • Robust immune response: Vaccination induced both humoral and cellular immune responses that correlated with:

    • Rapid bacterial clearance

    • Minimal tissue damage

    • Low inflammatory cytokine production in the lungs during pulmonary challenge

  • Detoxified variants: Even detoxified OMVs (OMV YptbS45-Bla-V) afforded 90% protection against pulmonary challenge with 50 LD₅₀ of Y. pestis and complete protection against subcutaneous challenge .

These findings suggest that recombinant Y. pseudotuberculosis OMVs delivering Y. pestis protective antigens represent promising next-generation plague vaccine candidates that address limitations of current vaccine approaches.

What bioinformatic approaches are useful for analyzing lgt sequence conservation across Yersinia species?

Several bioinformatic approaches have proven valuable for analyzing lgt conservation and evolution:

  • Multiple sequence alignment (MSA): Tools like MUSCLE, CLUSTALW, or T-Coffee can align lgt sequences from different Yersinia species and strains to identify:

    • Core conserved residues essential for function

    • Variable regions that may influence substrate specificity

    • Species-specific sequence signatures

  • Phylogenetic analysis: Methods including Maximum Likelihood, Bayesian inference, or Neighbor-Joining can be applied to:

    • Reconstruct evolutionary relationships of lgt across species

    • Identify potential horizontal gene transfer events

    • Correlate lgt sequence variations with pathogenicity

  • Structural prediction and comparison:

    • Homology modeling based on E. coli lgt crystal structure

    • Analysis of conservation mapping onto structural models

    • Prediction of functional consequences of sequence variations

  • Comparative genomics:

    • Examination of lgt genomic context across Yersinia species

    • Identification of co-evolving genes in the lipoprotein processing pathway

    • Detection of regulatory elements that control lgt expression

When conducting these analyses, it's important to include diverse Yersinia isolates representing different:

  • Species (Y. pseudotuberculosis, Y. pestis, Y. enterocolitica)

  • Serotypes (including IB specifically)

  • Geographical origins

  • Clinical vs. environmental isolates

How should discrepancies between in vitro and in vivo lgt activity data be addressed?

Researchers often encounter differences between lgt activity measured in vitro and observed effects in vivo. Strategies to reconcile such discrepancies include:

  • Examining experimental conditions:

    • Membrane environment: Using liposomes or nanodiscs that better mimic native membranes

    • Substrate availability: Ensuring physiologically relevant concentrations of phosphatidylglycerol and prolipoproteins

    • Cofactor requirements: Investigating potential missing cofactors in in vitro systems

  • Considering regulatory factors:

    • Post-translational modifications that may occur in vivo but not in vitro

    • Protein-protein interactions that influence activity

    • Environmental signals (pH, ion concentration) that modify enzyme behavior

  • Employing complementary approaches:

    • Coupling in vitro biochemical assays with cellular assays

    • Using conditional knockdowns to assess partial loss-of-function

    • Utilizing targeted metabolomics to track lipid modifications in situ

  • Statistical analysis:

    • Performing meta-analysis when multiple datasets exist

    • Applying appropriate statistical tests to determine significance of discrepancies

    • Using Bland-Altman plots to systematically compare methods

Remember that in vitro systems, while valuable for mechanistic studies, cannot fully recapitulate the complex environment of a living bacterial cell. A combination of approaches is typically required to develop a complete understanding of lgt function.

What are common pitfalls in experimental design when studying Y. pseudotuberculosis lgt and how can they be avoided?

Several common pitfalls can undermine Y. pseudotuberculosis lgt research:

PitfallImpactPrevention Strategy
Inadequate controlsMisleading interpretation of resultsInclude positive controls (known functional lgt), negative controls (enzymatically inactive mutants), and vector-only controls
Insufficient characterization of recombinant proteinsUnclear whether observed effects are due to lgt itselfVerify protein expression, localization, folding, and basic enzymatic activity before complex experiments
Inappropriate growth conditionsAltered lgt expression or activityUse conditions that mimic relevant in vivo environments; test multiple conditions when appropriate
Cross-contamination between Yersinia strainsConfounded resultsImplement rigorous laboratory practices; verify strain identity regularly through PCR or sequencing
Overlooking serotype differencesFailure to recognize strain-specific effectsClearly document strain characteristics including serotype; compare results across multiple strains when possible
Inconsistent animal modelsDifficulty comparing results across studiesFollow standardized protocols for animal infections ; report detailed methodologies
Inadequate statistical powerInability to detect significant effectsPerform power calculations before experiments; use appropriate sample sizes and statistical tests

Additionally, researchers should be aware that Y. pseudotuberculosis is a biosafety level 2 pathogen, requiring appropriate containment measures and safety protocols during experimental work.

How can structural data on lgt be integrated with functional studies to advance therapeutic development?

The integration of structural and functional data offers powerful opportunities for therapeutic development targeting lgt:

  • Structure-based inhibitor design:

    • Utilizing crystal structures of lgt with bound inhibitors (e.g., palmitic acid) to identify key binding interactions

    • Performing in silico docking studies to screen potential inhibitor candidates

    • Rationally designing compounds that target the catalytic site or critical binding interfaces

  • Mechanistic validation:

    • Using site-directed mutagenesis of key residues identified in crystal structures to confirm their functional importance

    • Developing mechanism-based assays that specifically probe the catalytic steps revealed by structural studies

    • Testing inhibitor binding modes through crystallography or other biophysical methods

  • Resistance prediction and mitigation:

    • Analyzing the conservation of binding site residues across bacterial species

    • Identifying potential resistance mutations through evolutionary analysis

    • Designing inhibitor combinations or multi-target inhibitors to reduce resistance development

  • Translational approach:

    • Progressing from biochemical assays to cellular systems and animal models

    • Correlating inhibition of enzymatic activity with bacterial growth inhibition and in vivo efficacy

    • Addressing pharmacokinetic and pharmacodynamic considerations based on structural insights

The crystal structures of E. coli lgt in complex with phosphatidylglycerol and palmitic acid at 1.9 and 1.6 Å resolution provide excellent templates for such integrative approaches aimed at targeting Y. pseudotuberculosis lgt.

What emerging technologies could advance our understanding of Y. pseudotuberculosis lgt function?

Several cutting-edge technologies hold promise for deepening our understanding of lgt biology:

  • Cryo-electron microscopy (cryo-EM):

    • Visualizing lgt in its native membrane environment

    • Capturing conformational changes during the catalytic cycle

    • Determining structures of larger lgt-containing complexes

  • Single-molecule techniques:

    • Tracking lgt activity at the single-molecule level

    • Measuring binding kinetics of substrates and inhibitors

    • Observing conformational dynamics during catalysis

  • CRISPR-based approaches:

    • Creating comprehensive libraries of lgt variants

    • Performing high-throughput functional screens

    • Establishing conditional knockdown systems for essential genes

  • Advanced imaging:

    • Super-resolution microscopy to visualize lgt localization in bacterial membranes

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Live-cell imaging to track lipoproteins through the processing pathway

  • Integrative multi-omics:

    • Combining proteomics, lipidomics, and transcriptomics

    • Mapping the complete lipoprotein landscape in Y. pseudotuberculosis

    • Identifying condition-specific changes in lgt expression and activity

  • Synthetic biology:

    • Engineering minimal systems to study lgt function

    • Creating reporter strains for high-throughput screening

    • Developing switchable lgt variants for temporal control of activity

These technologies, applied in combination, could address remaining questions about lgt mechanism, regulation, and potential as a therapeutic target.

How might computational approaches enhance the design of lgt inhibitors with therapeutic potential?

Computational methods offer powerful tools for lgt inhibitor design:

  • Virtual screening and molecular docking:

    • Using the E. coli lgt crystal structure as a template for Y. pseudotuberculosis lgt

    • Screening large compound libraries against the substrate binding site

    • Prioritizing candidates based on predicted binding energy and interactions

  • Molecular dynamics simulations:

    • Modeling lgt behavior in membrane environments

    • Identifying transient binding pockets not visible in static crystal structures

    • Predicting the effects of mutations on inhibitor binding

  • Machine learning approaches:

    • Training models on known lgt inhibitors and their properties

    • Predicting new chemical scaffolds with potential activity

    • Optimizing physicochemical properties for membrane penetration

  • Quantum mechanical calculations:

    • Modeling the reaction mechanism at the electronic level

    • Designing transition-state analogs as potential inhibitors

    • Optimizing electronic properties of candidate inhibitors

  • Systems biology modeling:

    • Predicting consequences of lgt inhibition on bacterial physiology

    • Identifying potential compensatory mechanisms or resistance pathways

    • Designing combination strategies to enhance efficacy

When applying these approaches, researchers should consider both the conservation of binding sites across species and the specificity needed to target bacterial rather than host enzymes.

What are the most significant unanswered questions regarding Y. pseudotuberculosis lgt?

Despite significant advances, several important questions about Y. pseudotuberculosis lgt remain unanswered:

  • Regulation of activity: How is lgt activity regulated in response to environmental conditions and stress?

  • Substrate specificity: What determines the preference for certain prolipoproteins over others, particularly in the context of virulence-associated lipoproteins?

  • Membrane interactions: How does lgt interact with other components of the lipoprotein processing machinery in the membrane?

  • Serotype-specific variations: Do functional differences exist in lgt across different Y. pseudotuberculosis serotypes, including serotype IB?

  • Evolutionary considerations: How has lgt evolved in Y. pseudotuberculosis relative to Y. pestis, and what implications does this have for pathogenesis?

  • Inhibitor development: Can selective inhibitors be developed that target Y. pseudotuberculosis lgt while sparing beneficial bacteria in the microbiome?

  • Vaccine applications: Can the understanding of lgt-processed lipoproteins be leveraged to develop improved vaccines against both Y. pseudotuberculosis and Y. pestis ?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.