Recombinant Yersinia pseudotuberculosis serotype IB Protein AaeX (aaeX)

Shipped with Ice Packs
In Stock

Description

Research Applications

AaeX is primarily used to study Yersinia pathogenesis and host immune responses.

3.1. Immunological Studies

  • Antibody Development: Recombinant AaeX serves as an antigen for generating serotype-specific antibodies, aiding in diagnostic assays .

  • ELISA: Quantitative detection of anti-AaeX antibodies in serum samples to assess immune responses .

3.2. Functional Analysis

  • Cellular Assays: While direct evidence for AaeX’s role is limited, its homology to effector proteins suggests potential involvement in:

    • Host cell adhesion or invasion (analogous to Invasin’s integrin-binding activity) .

    • Modulation of cytokine signaling (similar to YopJ’s inhibition of TNF-α) .

Comparative Analysis with Related Proteins

AaeX is distinct from other Yersinia virulence factors but shares structural or functional parallels with:

ProteinFunctionKey Differences
InvasinIntegrin-binding invasion protein Larger size (800–900 kDa laminin-like structure)
YopTRho GTPase-activating protein Targets RhoA directly via isoprenyl cleavage
YadAAdhesin mediating host cell contact Pilus-like structure, chromosomal origin

Challenges and Future Directions

  • Functional Elucidation: Current research lacks direct evidence of AaeX’s role in Yersinia pathogenesis. Further studies are needed to:

    • Identify host targets (e.g., integrins, Rho GTPases).

    • Assess its contribution to bacterial survival or immune evasion.

  • Diagnostic Potential: AaeX could be a biomarker for serotyping Y. pseudotuberculosis strains, though validation is required.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
aaeX; YPTS_3734; Protein AaeX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-67
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
aaeX
Target Protein Sequence
MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVWHPALFNTALYCCLFY LTSRLFS
Uniprot No.

Target Background

Database Links
Protein Families
AaeX family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.