Recombinant Yersinia pseudotuberculosis serotype IB Spermidine export protein MdtI (mdtI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its inclusion.
Synonyms
mdtI; YPTS_2113; Spermidine export protein MdtI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
mdtI
Target Protein Sequence
MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYAMWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS
Uniprot No.

Target Background

Function
Catalyzes spermidine excretion.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtI subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtI protein and what is its primary function in bacterial cells?

MdtI (Spermidine export protein) is a membrane protein that functions as part of the MdtJI complex, which catalyzes the excretion of spermidine from bacterial cells . This protein belongs to the small multidrug resistance (SMR) family of drug exporters . In Yersinia pseudotuberculosis serotype O:1b, MdtI consists of 109 amino acids and plays a crucial role in polyamine homeostasis by facilitating the export of excess spermidine, which can become toxic when overaccumulated within the cell .

The protein's function is particularly important for bacterial survival under conditions of high spermidine concentration. Research has demonstrated that the MdtJI complex reduces cellular spermidine content when bacteria are cultured in media containing elevated spermidine concentrations (2 mM), thereby preventing toxicity and growth inhibition . This polyamine export mechanism represents an important aspect of bacterial physiology and stress response.

How does MdtI operate in relation to the MdtJ protein?

MdtI does not function independently but operates as part of a protein complex with MdtJ. Studies have conclusively demonstrated that both proteins are necessary for effective spermidine excretion . When examining the recovery from spermidine toxicity, researchers found that transformation with plasmids encoding both MdtJ and MdtI (pUCmdtJI or pMWmdtJI) was required to rescue growth inhibition in bacterial strains deficient in spermidine acetyltransferase .

The genes for these proteins exist in an operon structure, suggesting coordinated expression and function . Experimental evidence indicates that the MdtJI complex formation is essential for spermidine excretion, as neither protein alone provides the necessary export activity. The level of mdtJI mRNA increases in response to elevated spermidine concentrations, indicating that expression of the complex is regulated by substrate availability .

Which specific amino acid residues are critical for MdtI function, and how were they identified?

Research has identified five specific amino acid residues in MdtI that are crucial for its spermidine export activity: Glu5, Glu19, Asp60, Trp68, and Trp81 . These residues were identified through site-directed mutagenesis experiments performed using constructs encoding both MdtJ and MdtI proteins.

Researchers employed two main approaches for site-directed mutagenesis: overlap extension using PCR and the QuikChange site-directed mutagenesis kit . After creating mutant variants, functional assays evaluated the mutants' ability to recover cells from spermidine toxicity. Additionally, spermidine excretion was measured directly using radiolabeled [14C]spermidine to track export activity .

The identified residues likely perform different functions in the transport mechanism. The acidic residues (Glu5, Glu19, and Asp60) may interact with the positively charged polyamine substrate, while the aromatic tryptophan residues (Trp68 and Trp81) might contribute to substrate binding pocket formation or protein structural stability. These findings provide important insights for structure-function studies and potential drug design targeting this transporter .

How does the MdtI protein from Y. pseudotuberculosis compare to homologous proteins in other bacterial species?

The MdtI protein belongs to the SMR family of transporters, which are widely distributed across bacterial species. In Escherichia coli, MdtI (previously known as YdgE) forms a complex with MdtJ (YdgF) that functions similarly to export spermidine . Comparative analysis reveals conservation of key functional residues across these homologs.

While the E. coli MdtJI complex has been more extensively characterized, the Y. pseudotuberculosis MdtI shares significant sequence similarity, suggesting functional conservation. Both proteins require partnership with MdtJ for activity, and both are involved in polyamine homeostasis. The conservation of this system across different bacterial genera highlights its fundamental importance in cellular physiology .

Importantly, understanding these homologous relationships provides insights into potential broad-spectrum antimicrobial strategies targeting polyamine transport. Researchers should note that while core functions appear conserved, species-specific differences may exist in regulation, substrate specificity, or interaction partners that warrant investigation in the specific bacterial context .

What experimental approaches can be used to study the interaction between MdtI and MdtJ?

Several experimental approaches can be employed to study the MdtI-MdtJ interaction:

  • Co-expression and co-purification: Both proteins can be co-expressed using plasmids like pUCmdtJI or pMWmdtJI, followed by affinity purification using tags (such as the His tag present in some constructs) . Successful co-purification would provide evidence of complex formation.

  • Functional complementation assays: As demonstrated in previous research, transformation of spermidine-sensitive strains (like E. coli CAG2242) with plasmids encoding both proteins can assess functional interaction through growth recovery and spermidine excretion .

  • Site-directed mutagenesis: Targeted mutations in potential interaction interfaces can identify residues critical for complex formation versus those important for substrate binding or transport .

  • Membrane reconstitution experiments: Purified proteins can be reconstituted into liposomes to assess transport activity in a defined system.

  • Protein crosslinking: Chemical crosslinking followed by mass spectrometry can identify residues in close proximity, providing structural insights into the interaction.

These approaches can be combined to develop a comprehensive understanding of how MdtI and MdtJ interact to form a functional spermidine export complex .

What methods can be used to measure MdtI-mediated spermidine export activity?

Several established methods can quantify MdtI-mediated spermidine export activity:

  • Radiolabeled spermidine efflux assays: Cells preloaded with [14C]spermidine can be monitored for export activity by measuring the decrease in intracellular radioactivity over time. This approach has been successfully employed to demonstrate enhanced spermidine excretion in cells expressing the MdtJI complex .

  • Intracellular polyamine quantification: Direct measurement of intracellular spermidine content using methods such as HPLC can assess export activity. Previous research has shown that cells expressing MdtJI maintain lower intracellular spermidine levels when cultured in high-spermidine media (2 mM) .

  • Growth recovery assays: In strains deficient in spermidine acetyltransferase (like E. coli CAG2242), growth inhibition by spermidine can be rescued by functional MdtJI expression. This provides an indirect measure of export activity .

  • Fluorescent spermidine analogs: Newer approaches using fluorescently labeled polyamine analogs may allow real-time visualization of transport.

When conducting these assays, researchers should include appropriate controls, such as vector-only transformants and known non-functional mutant variants of MdtI or MdtJ, to validate their findings .

How can recombinant MdtI protein be optimally expressed and purified for structural and functional studies?

Optimal expression and purification of recombinant MdtI involves several critical considerations:

  • Expression system selection: For membrane proteins like MdtI, E. coli expression systems with inducible promoters (such as pT5/lac) have proven effective . Expression can be induced using IPTG under controlled conditions.

  • Affinity tags: Incorporating affinity tags facilitates purification. His-tagged constructs of MdtI have been successfully used, with the tag typically placed at the N-terminus to minimize interference with function .

  • Detergent selection: As a membrane protein, MdtI requires appropriate detergents for solubilization and purification. Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LDAO (lauryldimethylamine oxide) are typically suitable starting points.

  • Storage conditions: Purified MdtI should be stored in buffer containing 50% glycerol at -20°C for short-term storage or -80°C for extended storage, avoiding repeated freeze-thaw cycles .

  • Quality control: Verify protein identity and purity using methods such as SDS-PAGE, Western blotting, and mass spectrometry. Functional activity should be assessed after purification to ensure the protein retains its native conformation.

For co-purification of the MdtJI complex, co-expression strategies followed by tandem affinity purification may yield better results than attempting to reconstitute the complex from individually purified components .

What controls should be included when studying MdtI function in experimental systems?

When investigating MdtI function, the following controls are essential:

  • Vector-only control: Cells transformed with the empty vector provide a baseline for comparing the effects of MdtI expression .

  • Single protein controls: Since MdtI functions as part of a complex with MdtJ, expressing each protein individually helps demonstrate their interdependence .

  • Mutant variants: Non-functional mutants (e.g., E5A, E19A, D60A, W68A, or W81A in MdtI) serve as negative controls for specific residue contributions .

  • Substrate specificity controls: Testing export of other polyamines (like putrescine) or unrelated compounds helps confirm specificity of the transport system .

  • Strain controls: Using both wild-type strains and those deficient in spermidine metabolism (like spermidine acetyltransferase-deficient strains) provides complementary insights into transporter function under different cellular conditions .

  • Expression level controls: Verifying comparable expression levels when comparing different constructs ensures that functional differences are not simply due to varying protein abundance.

These controls collectively help establish the specificity, dependency relationships, and mechanistic details of MdtI function as part of the spermidine export machinery .

How might understanding MdtI function contribute to antimicrobial development against Yersinia species?

Understanding MdtI function could contribute to antimicrobial development against Yersinia species in several ways:

  • Novel drug target identification: As a membrane transporter involved in polyamine homeostasis, MdtI represents a potential target for new antimicrobials. Inhibitors blocking MdtI function could lead to toxic accumulation of spermidine in bacterial cells, particularly under conditions where polyamine levels are elevated .

  • Virulence modulation: While direct evidence linking MdtI to virulence in Yersinia pseudotuberculosis is limited, polyamine metabolism has been associated with bacterial pathogenicity in other species. Targeting MdtI could potentially attenuate bacterial virulence or survival during infection .

  • Cross-species applications: Given the conservation of MdtI across bacterial species, antimicrobials targeting this protein could potentially have broad-spectrum activity against multiple pathogens, including the three main Yersinia species that affect humans (Y. pestis, Y. pseudotuberculosis, and Y. enterocolitica) .

  • Combination therapy approaches: Inhibitors of MdtI could be developed as adjuncts to existing antibiotics, potentially enhancing their efficacy by disrupting bacterial stress responses and homeostatic mechanisms.

The development of such targeted approaches would require further structural and functional characterization of MdtI, particularly in the context of the intact MdtJI complex .

What is the relationship between polyamine transport and bacterial stress responses?

Polyamine transport, including spermidine export via the MdtJI complex, plays a significant role in bacterial stress responses:

  • Polyamine homeostasis: Bacteria must maintain appropriate intracellular polyamine levels, as both deficiency and excess can be detrimental to cellular function. MdtJI helps regulate spermidine levels by exporting excess polyamines, preventing toxic accumulation .

  • Transcriptional regulation: Research has shown that spermidine exposure increases mdtJI mRNA levels, indicating that the export system itself responds to substrate availability through transcriptional regulation .

  • Growth under stress conditions: The ability to export excess spermidine via MdtJI allows bacteria to grow in environments with high polyamine concentrations that would otherwise be inhibitory. This may be particularly relevant during host infection or in specific ecological niches .

  • Cross-resistance potential: Polyamine transport systems like MdtJI may contribute to resistance against certain antimicrobial compounds through efflux mechanisms, though this potential cross-functionality requires further investigation.

Understanding these relationships provides insights into bacterial adaptation strategies and potential vulnerabilities that could be exploited for antimicrobial development or modulation of bacterial physiology .

What emerging technologies could advance the study of MdtI structure and function?

Several emerging technologies hold promise for advancing MdtI research:

  • Cryo-electron microscopy (cryo-EM): This technique could reveal the three-dimensional structure of the MdtJI complex at near-atomic resolution, providing insights into the transport mechanism and substrate binding sites.

  • Single-molecule tracking: Advanced microscopy methods could allow real-time visualization of transport events mediated by individual MdtJI complexes in living cells.

  • Computational modeling and molecular dynamics: These approaches can predict structural changes during the transport cycle and identify potential binding sites for inhibitors.

  • CRISPR-based genome editing: Precise modification of the native mdtI gene in Yersinia pseudotuberculosis could help evaluate its role in physiological contexts beyond heterologous expression systems.

  • Synthetic biology approaches: Designer MdtI variants with modified substrate specificity or regulatory properties could elucidate structure-function relationships and potentially lead to biotechnological applications.

These technologies could address current knowledge gaps regarding the structural basis of MdtI-MdtJ interaction, the transport mechanism, and the physiological role of this system in various bacterial species .

How does the MdtI-mediated transport mechanism compare to other bacterial polyamine transporters?

The MdtI-mediated transport mechanism can be compared to other bacterial polyamine transporters across several dimensions:

  • Transport direction: Unlike polyamine uptake systems, MdtJI functions as an exporter, removing excess spermidine from the cell . This contrasts with well-characterized polyamine import systems such as the PotABCD and PotFGHI transporters.

  • Energy coupling: While many transporters utilize ATP hydrolysis (ABC transporters) or ion gradients (secondary transporters), the exact energy coupling mechanism of MdtJI remains to be fully characterized. As members of the SMR family, they likely utilize proton motive force .

  • Substrate specificity: MdtJI appears relatively specific for spermidine compared to other polyamines like putrescine . This contrasts with some transporters that handle multiple polyamine species with varying affinities.

  • Structural organization: Unlike larger multi-component transporters, the MdtJI complex is composed of just two small membrane proteins working together, representing a relatively simple transport system .

  • Regulatory control: The observed increase in mdtJI mRNA levels in response to spermidine suggests substrate-induced regulation, which may differ from constitutive or alternative regulatory mechanisms employed by other polyamine transporters .

Further comparative studies could reveal evolutionary relationships between different polyamine transport systems and identify conserved mechanistic principles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.