Recombinant Yersinia pseudotuberculosis serotype IB Spermidine export protein MdtJ (mdtJ)

Shipped with Ice Packs
In Stock

Description

Overview of MdtJ and Its Biological Role

MdtJ is a chromosome-encoded protein in Yersinia pseudotuberculosis serotype IB, designated by the UniProt ID B2K336. It belongs to the spermidine export protein family, which facilitates the efflux of polyamines such as spermidine. Polyamines are critical for bacterial growth under stress conditions, including osmotic stress, oxidative stress, and nutrient deprivation .

Key Features of MdtJDetails
Gene NamemdtJ
SynonymsYPTS_2112, Spermidine export protein MdtJ
Protein LengthFull-length (1–147 amino acids)
Host OrganismE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)

Production and Purification Parameters

Recombinant MdtJ is produced via heterologous expression in E. coli, with standardized protocols for yield and quality.

Unanswered Questions

  1. Mechanism of Action: How MdtJ interacts with polyamine substrates and membrane components.

  2. Pathogenicity: Whether MdtJ contributes to Yersinia survival in host tissues.

  3. Evolutionary Conservation: Functional similarities/differences across Yersinia species .

Comparative Analysis with Homologs

OrganismUniProt IDLength (aa)Key Differences
Y. pseudotuberculosisB2K336147Native sequence with Thr at position 95 .
Y. pestisA4TJJ0147Pro at position 95; altered membrane-interacting residues .
S. glossinidiusQ2NVC0126Shorter C-terminus; distinct export efficiency .

Experimental Applications

MdtJ is used in:

  • Protein-Protein Interaction Studies: Analyzing substrate binding via SPR or ITC.

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve transporter conformation.

  • Host-Pathogen Research: Investigating polyamine metabolism in Yersinia infections .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timeframes.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
mdtJ; YPTS_2112; Spermidine export protein MdtJ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
mdtJ
Target Protein Sequence
MIYWIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKKVALGVAY ALWEGIGILIITIFSVMWFGETLSPLKIAGLVTLIGGILLVKSGTRKPKQPNRHRGNRPP SVQGLKTQTTGHHKGVAVESGEHHAAA
Uniprot No.

Target Background

Function
Catalyzes the excretion of spermidine.
Database Links
Protein Families
Small multidrug resistance (SMR) protein family, MdtJ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the MdtJ protein in Yersinia pseudotuberculosis and how does it function?

MdtJ is a spermidine export protein that functions as part of the MdtJI protein complex in Yersinia pseudotuberculosis. Based on studies in E. coli, this complex belongs to the small multidrug resistance (SMR) family of drug exporters and is responsible for the excretion of spermidine from bacterial cells . The MdtJI complex plays a crucial role in polyamine homeostasis by preventing toxic accumulation of spermidine within the bacterial cell.

Both the MdtJ and MdtI components are necessary for functional spermidine export activity. Experimental data indicates that specific amino acid residues in both proteins contribute to this function, with key residues in MdtJ including Tyr4, Trp5, Glu15, Tyr45, Tyr61, and Glu82 . The protein complex forms a transmembrane channel that facilitates the export of spermidine across the bacterial cell membrane.

How is the mdtJ gene regulated in Y. pseudotuberculosis?

The regulation of mdtJ expression in Y. pseudotuberculosis involves several mechanisms, particularly in response to polyamine levels. Studies in related bacteria have shown that spermidine itself can increase the expression of mdtJI mRNA , suggesting an autoregulatory feedback mechanism that responds to elevated intracellular spermidine concentrations.

In the context of Y. pseudotuberculosis vaccine strains, the expression of mdtJ may be influenced by genetic modifications introduced to attenuate virulence while maintaining immunogenicity. For instance, in the attenuated strain Yptb1(pYA5199), which contains deletions in several key virulence factors including yopK and yopJ, the expression profile of various transporters including MdtJ may be altered compared to wild-type strains .

What experimental methods are used to study MdtJ function in bacterial systems?

Experimental ApproachApplication to MdtJ ResearchKey Technical Considerations
Gene knockout studiesCreate mdtJ deletion mutants to assess phenotypic changesRequires precise genetic manipulation tools specific for Y. pseudotuberculosis
Protein expression systemsProduce recombinant MdtJ for functional and structural studiesOften requires optimization of expression conditions for membrane proteins
Spermidine toxicity assaysEvaluate MdtJ's role in spermidine toleranceMust control for other polyamine transport systems
mRNA expression analysisDetermine transcriptional regulation of mdtJCan be performed via RT-qPCR or RNA-seq approaches
Polyamine transport assaysDirectly measure spermidine export functionOften uses radiolabeled or fluorescently tagged spermidines

Researchers typically employ complementation experiments where the mdtJ gene is reintroduced (often on a plasmid) to confirm that observed phenotypes are specifically due to the absence of MdtJ. For instance, studies in E. coli demonstrated that transformation with pUCmdtJI or pMWmdtJI (encoding both MdtJ and MdtI) recovered normal growth in spermidine acetyltransferase-deficient strains exposed to high spermidine concentrations .

How does the MdtJI complex in Y. pseudotuberculosis compare structurally and functionally to that in E. coli?

The MdtJI complex in Y. pseudotuberculosis shares significant homology with its E. coli counterpart, but with distinct characteristics reflecting evolutionary adaptations to different environmental niches. Comparative analysis reveals:

FeatureE. coli MdtJIY. pseudotuberculosis MdtJISignificance
Protein sequence identityReference standardApproximately 70-85% identityFunctional conservation with species-specific variations
Critical residuesTyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82 (MdtJ); Glu5, Glu19, Asp60, Trp68, Trp81 (MdtI) Mostly conserved but with species-specific substitutionsThese residues form the spermidine binding and transport channel
Expression regulationUpregulated by spermidine Similar feedback regulation presumedSuggests conserved regulatory mechanisms
Membrane topology4 transmembrane segmentsPredicted to have identical topologyStructural conservation of SMR family proteins
Functional oligomerizationHeterodimer required for function Also requires both MdtJ and MdtI componentsConsistent functional architecture across species

The E. coli MdtJI complex has been more extensively characterized, with specific amino acid residues identified as critical for function through site-directed mutagenesis studies . The corresponding residues in Y. pseudotuberculosis MdtJ likely serve similar roles but may exhibit differential affinities or transport kinetics reflecting the specific physiological requirements of this pathogen.

What are the implications of MdtJ function for Y. pseudotuberculosis virulence and host interactions?

The MdtJ protein's role in spermidine export has significant implications for Y. pseudotuberculosis virulence, particularly regarding:

  • Polyamine homeostasis during infection: Y. pseudotuberculosis encounters varying polyamine concentrations in different host environments. The MdtJ-mediated export system helps maintain optimal intracellular spermidine levels, which is critical for bacterial survival and virulence gene expression.

  • Stress response during host colonization: During infection, bacteria face numerous stresses including oxidative and acid stress. Polyamines like spermidine protect against these stresses, and MdtJ's regulation of spermidine levels contributes to stress adaptation.

  • Interaction with host immune responses: Y. pseudotuberculosis with mutations in virulence factors like YopJ and YopK (as in the Yptb1 strain) show altered interactions with host immune cells . The MdtJ protein may influence these interactions by affecting bacterial metabolism and stress responses during immune challenge.

  • Colonization of different tissues: The Yptb1(pYA5199) attenuated strain shows distinctive colonization patterns, including rapid dissemination to the lungs compared to other strains . Polyamine transporters like MdtJ may contribute to this tissue tropism by enabling adaptation to tissue-specific microenvironments.

How can recombinant Y. pseudotuberculosis strains with modified MdtJ be utilized in vaccine development?

Recombinant Y. pseudotuberculosis strains have shown promising results as live vaccine platforms, particularly against Y. pestis. The potential applications of MdtJ-modified strains include:

Vaccine Design StrategyScientific RationaleExperimental Evidence
MdtJ as an antigen carrierMdtJ's membrane localization makes it a potential fusion partner for delivering heterologous antigensConceptual approach based on membrane protein display systems
MdtJ modification for attenuated growthControlled polyamine export could create balanced attenuation without compromising immunogenicityNot directly tested, but related attenuated Y. pseudotuberculosis strains demonstrate promising immunogenicity
MdtJ regulation to enhance persistenceModified MdtJ expression could extend vaccine strain persistence in specific tissuesYptb1(pYA5199) shows extended persistence in tissues including Peyer's patches, lung, spleen, and liver
Combination with other attenuating mutationsMdtJ modifications could complement existing attenuating strategies (e.g., Δasd, ΔyopK, ΔyopJ)The Yptb1(pYA5199) strain combines multiple attenuating mutations while maintaining immunogenicity

Experimental evidence with the Yptb1(pYA5199) strain, which delivers Y. pestis antigens LcrV and F1, demonstrates that properly attenuated Y. pseudotuberculosis can stimulate robust antibody responses and provide protection against Y. pestis challenge in both mice and rats . This strain induces significant increases in antigen-specific CD4+ and CD8+ T cells producing important cytokines including IFN-γ, IL-17A, and TNF-α .

What are the optimal expression systems for producing recombinant MdtJ protein for structural and functional studies?

Producing functional recombinant MdtJ presents several challenges due to its nature as a membrane protein. The following expression systems have proven effective for similar membrane transporters:

Critical considerations for functional expression include:

  • Co-expression with MdtI is essential, as both proteins are required for functional spermidine export activity .

  • Addition of appropriate fusion tags (His, FLAG, etc.) for purification should be carefully positioned to avoid disrupting protein folding or oligomerization.

  • Detergent selection for membrane extraction is crucial; mild detergents like DDM or LMNG often preserve functional integrity.

  • Validation of functional activity should include spermidine transport assays following reconstitution into proteoliposomes.

How can researchers effectively analyze the impact of point mutations in MdtJ on spermidine export function?

Analysis of MdtJ point mutations requires systematic approaches to correlate structure with function:

  • Site-directed mutagenesis strategy:

    • Target conserved residues identified in homologous proteins (e.g., Tyr4, Trp5, Glu15, Tyr45, Tyr61, Glu82 in E. coli MdtJ)

    • Create both conservative and non-conservative substitutions

    • Generate alanine-scanning libraries across transmembrane domains

  • Functional validation methods:

    • Complementation assays in mdtJ-deficient bacteria grown with toxic spermidine concentrations

    • Direct measurement of [14C]-spermidine uptake/export

    • Membrane potential measurements to assess coupling to ion gradients

    • Protein expression verification via Western blotting

  • Structural correlation approaches:

    • Molecular dynamics simulations to predict effects of mutations

    • Cross-linking studies to identify interaction interfaces between MdtJ and MdtI

    • Cryo-EM or X-ray crystallography (challenging but valuable for membrane proteins)

When analyzing experimental results, researchers should consider that:

  • Some mutations may affect protein stability rather than transport function directly

  • Compensatory mutations may arise during complementation experiments

  • Spermidine transport may be influenced by other polyamine transporters with overlapping specificity

What approaches can identify potential contradictions in experimental results when studying MdtJ function?

Contradictions in experimental results regarding MdtJ function can arise from multiple sources. A systematic approach to identify and resolve these contradictions includes:

Source of ContradictionDetection MethodResolution Strategy
Strain background differencesCompare results across multiple strainsStandardize genetic backgrounds; create isogenic strains
Growth condition variationsCarefully document media, pH, temperatureEstablish standardized growth protocols; test across conditions
Polyamine measurement artifactsUse multiple detection methods (HPLC, LC-MS)Include internal standards; validate with radioisotope methods
MdtJ vs. MdtJI complex functionTest individual and combined expressionAlways include appropriate controls for both proteins
Overlapping transport systemsCreate multiple knockout combinationsUse inhibitors and competitive substrates to isolate specific transporter functions
Host-specific effects in virulence studiesTest in multiple animal modelsThe Yptb1(pYA5199) strain shows different distribution patterns in mice vs. rats

For example, researchers studying Y. pseudotuberculosis vaccine strains observed that the Yptb1(pYA5199) strain disseminated to the lungs more rapidly than the PB1+ strain . Without careful experimental controls and replications, this observation might seem contradictory to expectations for an attenuated strain. The authors hypothesized this might relate to the yopK and yopJ double mutations affecting phagocyte interactions, but acknowledged further studies are needed to validate this hypothesis .

How does understanding MdtJ function contribute to novel antimicrobial development strategies?

The MdtJ protein and the broader MdtJI complex represent potential targets for novel antimicrobial strategies based on several mechanistic principles:

  • Direct inhibition of polyamine export: Compounds that specifically block MdtJI function could lead to toxic accumulation of intracellular spermidine, particularly in environments with high polyamine concentrations.

  • Disruption of MdtJ-MdtI protein interaction: Since both proteins are required for function , compounds that prevent complex formation could effectively inhibit transport activity.

  • Exploitation of MdtJ as a drug entry pathway: The polyamine transport pathway might be leveraged to deliver antimicrobial compounds conjugated to polyamine analogs.

  • Targeting polyamine-dependent virulence mechanisms: Inhibition of MdtJ could indirectly affect virulence by disrupting polyamine homeostasis required for expression of virulence factors.

Research approaches to identify potential inhibitors include:

ApproachMethodologyExpected Outcomes
Structure-based drug designComputational docking to MdtJ binding sitesLead compounds for functional testing
High-throughput screeningFluorescent spermidine transport assaysNovel chemical scaffolds with inhibitory activity
Peptidomimetic inhibitorsDesign based on MdtJ-MdtI interaction surfacesSelective disruptors of complex formation
Natural product screeningTesting polyamine analogs from microbial sourcesBio-inspired inhibitor candidates

What are the most promising future directions for studying MdtJ function in pathogenic Yersinia species?

Future research on MdtJ in pathogenic Yersinia should focus on several key directions:

  • Comparative analysis across Yersinia species: Investigating differences in MdtJ function between Y. pseudotuberculosis, Y. pestis, and Y. enterocolitica could reveal species-specific adaptations related to their distinct disease manifestations.

  • Host-pathogen interaction studies: Exploring how MdtJ-mediated polyamine export affects interactions with host immune cells, particularly in the context of different tissue microenvironments encountered during infection.

  • Integration with systems biology approaches: Investigating how MdtJ function coordinates with global metabolic and virulence networks through transcriptomics, proteomics, and metabolomics.

  • In vivo expression and regulation studies: Determining how mdtJ expression changes during different stages of infection using reporter constructs and animal models.

  • Role in biofilm formation and persistence: Examining whether MdtJ contributes to Y. pseudotuberculosis biofilm formation and environmental persistence through polyamine export.

  • Structural biology of Y. pseudotuberculosis MdtJI complex: Determining the precise structure of the MdtJI complex from Y. pseudotuberculosis would enhance understanding of species-specific functional characteristics.

  • Safety evaluation of vaccine strains: Further investigation of the safety profile of attenuated Y. pseudotuberculosis vaccine strains like Yptb1(pYA5199) in immunocompromised models, addressing concerns raised about rapid dissemination to lungs .

Each of these research directions would contribute to a more comprehensive understanding of MdtJ's role in Yersinia biology and pathogenesis, potentially leading to novel therapeutic and preventive strategies against Yersinia infections.

What are the major challenges in differentiating MdtJ function from other polyamine transporters in Yersinia species?

Isolating MdtJ function presents several technical challenges due to the complexity of bacterial polyamine transport systems:

ChallengeTechnical ImpactSolution Strategies
Functional redundancyMultiple transporters may compensate for MdtJ deletionCreate combinatorial deletions of multiple transporters
Bidirectional transportDifficult to distinguish import vs. exportDevelop inside-out membrane vesicle assays
Expression regulationOther transporters may be upregulated when mdtJ is deletedUse inducible expression systems and time-course analyses
Substrate specificity overlapMdtJ may transport other polyamines besides spermidineTest transport of multiple labeled polyamines
Host-derived polyaminesDifficult to distinguish bacterial vs. host polyamines in infection modelsUse isotope-labeled polyamines; create host polyamine synthesis mutants

A comprehensive experimental approach might include:

  • Creating a panel of single and multiple transporter deletion mutants

  • Employing radioactive and fluorescent polyamine tracers with different chemical properties

  • Using membrane vesicle preparations to study transport direction

  • Applying competitive inhibitors specific to different transport systems

  • Performing transport studies under varying ionic and pH conditions to differentiate mechanism

How can researchers effectively assess the safety profile of attenuated Y. pseudotuberculosis strains expressing modified MdtJ?

Evaluating the safety of attenuated Y. pseudotuberculosis vaccine strains with modified MdtJ requires rigorous testing across multiple parameters:

  • Comprehensive virulence assessment:

    • Determination of LD50 in multiple animal models

    • Histopathological examination of multiple tissues

    • Long-term persistence studies (as performed with Yptb1(pYA5199))

    • Monitoring for reversion to virulence through serial passages

  • Immunocompromised host models:

    • Testing in B and T cell-deficient mice

    • Evaluation in IFN-γ deficient mice

    • Studies in SCID mice

    • Age-dependent studies (neonatal, geriatric models)

  • Organ-specific safety monitoring:

    • Special attention to lung colonization due to the observed rapid dissemination pattern

    • Assessment of intestinal barrier integrity

    • Monitoring for systemic inflammatory responses

    • Evaluation of microbiome disruption

  • Genetic stability assessment:

    • Whole genome sequencing after in vivo passage

    • Monitoring expression stability of key attenuating mutations

    • Evaluation of horizontal gene transfer potential

    • Assessment of plasmid retention in strains carrying recombinant plasmids

The Yptb1(pYA5199) strain showed no outward signs of disease in Swiss Webster mice and Brown Norway rats despite rapid systemic spread, particularly to the lungs . This raises important safety considerations that must be thoroughly investigated before clinical application, particularly for immunocompromised populations.

How does research on MdtJ in Y. pseudotuberculosis contribute to our broader understanding of bacterial transport systems?

Research on MdtJ in Y. pseudotuberculosis provides valuable insights into several broader aspects of bacterial physiology:

  • Evolution of SMR family transporters: Comparative analysis of MdtJ across Yersinia species and more distantly related bacteria helps illuminate the evolutionary trajectory of this important transporter family.

  • Polyamine homeostasis mechanisms: Understanding MdtJ function contributes to the broader picture of how bacteria maintain optimal polyamine levels across varying environmental conditions.

  • Membrane protein complex assembly: The required heterodimer formation between MdtJ and MdtI serves as a model system for studying membrane protein complex assembly and function.

  • Pathogen adaptation strategies: The specific characteristics of Y. pseudotuberculosis MdtJ likely reflect adaptations to its pathogenic lifestyle and the host environments it encounters.

  • Transport-virulence connections: MdtJ research helps establish connections between basic physiological processes (polyamine transport) and virulence mechanisms, bridging fundamental and applied microbiology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.