Recombinant Yersinia pseudotuberculosis serotype IB Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
The shelf life of the product depends on various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
msrQ; YPTS_3756; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
msrQ
Target Protein Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Uniprot No.

Target Background

Function
YedZ is a subunit of the MsrPQ system, which plays a crucial role in repairing oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) in *Yersinia pseudotuberculosis*. This repair process utilizes respiratory chain electrons. Therefore, MsrPQ protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by the host defense mechanisms. MsrPQ is essential for maintaining envelope integrity under bleach stress, rescuing a diverse range of structurally unrelated periplasmic proteins from methionine oxidation. MsrQ provides electrons for reduction to the reductase catalytic subunit MsrP, using the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does YedZ relate to bacterial sulfoxide reductase systems?

YedZ (MsrQ) functions as the heme-binding subunit of the protein-methionine-sulfoxide reductase system in Yersinia pseudotuberculosis. This system plays a crucial role in protecting bacteria against oxidative stress by reducing oxidized methionine residues in proteins. The heme group in YedZ serves as an electron transfer component, accepting electrons from the respiratory chain and transferring them to the catalytic subunit of the reductase system.

This redox function is particularly important for bacterial survival during host infection, as it helps the pathogen counter oxidative bursts generated by host immune cells. The YedZ protein works in conjunction with other components of the Msr system, forming a complete electron transfer pathway essential for protecting bacterial proteins against oxidative damage .

What are the optimal conditions for recombinant expression of YedZ protein?

The optimal expression of recombinant YedZ from Y. pseudotuberculosis has been achieved using E. coli as an expression host. Based on available research protocols, the following conditions yield high-quality recombinant protein:

  • Expression System: E. coli BL21(DE3) or similar strains optimized for membrane protein expression

  • Vector Selection: pET-based vectors with His-tag fusion at the N-terminus

  • Culture Conditions:

    • Initial growth at 37°C until OD600 reaches 0.6-0.8

    • Temperature reduction to 18-20°C prior to induction

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction expression for 16-18 hours

The expression of membrane proteins like YedZ presents unique challenges due to potential toxicity and improper folding. Slower expression at reduced temperatures helps to ensure proper membrane insertion and folding of the protein .

What purification strategies are most effective for obtaining high-purity YedZ protein?

Purification of YedZ requires specialized protocols due to its membrane-associated nature. A multi-step purification strategy has proven most effective:

  • Membrane Fraction Isolation:

    • Cell lysis by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

    • Separation of membrane fraction by ultracentrifugation (100,000 × g for 1 hour)

    • Solubilization of membrane proteins using 1% n-dodecyl-β-D-maltoside (DDM) or similar detergents

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Binding to Ni-NTA resin

    • Washing with buffer containing 20-40 mM imidazole

    • Elution with 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Final purification step to remove aggregates

    • Buffer containing 0.05% DDM to maintain protein solubility

This protocol typically yields >90% purity as assessed by SDS-PAGE. For long-term storage, purified YedZ should be supplemented with 6% trehalose and stored at -80°C to maintain stability and prevent freeze-thaw damage .

How should experiments be designed to accurately measure YedZ enzymatic activity?

Designing experiments to accurately measure YedZ enzymatic activity requires careful consideration of multiple parameters. Based on optimal experimental design principles for enzyme kinetics assessment, the following approach is recommended:

  • Sampling Strategy:

    • Use 15 strategically timed sampling points

    • Incubation times ranging from 0 to 40 minutes

    • Starting substrate concentrations (C₀) between 0.01 and 100 μM

  • Parameter Optimization:

    • Sample times and concentrations should be selected to minimize uncertainty (standard error) of parameter estimates

    • Utilize penalized expectation of determinant (ED)-optimal design with discrete parameter distribution

  • Data Analysis:

    • Apply both Michaelis-Menten (MM) equation and monoexponential decay models

    • Compare relative standard errors to determine best fit

This approach has been shown to generate better results for 99% of compounds and improves estimation of metabolic intrinsic clearance compared to standard approaches. For YedZ specifically, this methodology enables high-quality estimates (RMSE < 30%) of both Vₘₐₓ and Kₘ parameters .

What are the advanced considerations for analyzing YedZ electron transfer kinetics in membrane systems?

Analysis of YedZ electron transfer kinetics in membrane systems requires specialized approaches due to the complexity of membrane-associated redox reactions:

  • Membrane Reconstitution:

    • Reconstitute purified YedZ into proteoliposomes using E. coli lipid extracts

    • Maintain a protein-to-lipid ratio of 1:100 to 1:200 for optimal activity

    • Verify incorporation using freeze-fracture electron microscopy

  • Electron Transfer Measurements:

    • Utilize stopped-flow spectroscopy with rapid mixing (<2 ms dead time)

    • Monitor heme redox state through absorbance changes at 424 nm (reduced) and 408 nm (oxidized)

    • Measure electron transfer rates under pseudo-first-order conditions

  • Kinetic Model Development:

    • Apply multi-step electron transfer models accounting for:

      • Initial electron acceptance from donors

      • Intramolecular electron transfer

      • Transfer to acceptor proteins

    • Use global fitting algorithms to simultaneously analyze multiple spectroscopic datasets

  • Environmental Factors:

    • Systematically evaluate effects of pH (range 6.0-8.5)

    • Assess membrane fluidity effects using different lipid compositions

    • Measure temperature dependence (10-40°C) to determine activation energies

This comprehensive approach allows for detailed characterization of the electron transfer parameters essential for understanding YedZ function within the membrane environment and its role in the bacterial sulfoxide reductase system.

How does YedZ contribute to Yersinia pseudotuberculosis virulence?

YedZ (MsrQ) contributes to Y. pseudotuberculosis virulence through several mechanisms related to oxidative stress resistance during host infection:

  • Protection Against Oxidative Burst:

    • YedZ, as part of the methionine sulfoxide reductase system, helps protect bacterial proteins from oxidative damage caused by host immune cell-generated reactive oxygen species

    • This protection is particularly important during the early stages of infection when neutrophil and macrophage responses are robust

  • Maintenance of Bacterial Protein Function:

    • By reducing oxidized methionine residues, YedZ helps maintain the function of key virulence factors that might otherwise be inactivated by oxidative stress

    • This preserves bacterial fitness during host colonization

  • Potential Interaction with Type III Secretion System:

    • While direct evidence is limited, redox systems like YedZ may indirectly support Type III secretion system (T3SS) function by maintaining the redox status of critical components

    • The T3SS is essential for Y. pseudotuberculosis pathogenicity, delivering effector proteins that modulate host cell responses

Unlike the plasmid-encoded Yop proteins of the T3SS, YedZ is chromosomally encoded, representing a different aspect of the bacterium's virulence strategy focused on stress resistance rather than direct host cell manipulation .

What is the relationship between YedZ and macrophage interactions during Y. pseudotuberculosis infection?

The interaction between YedZ and host macrophages during Y. pseudotuberculosis infection represents a critical aspect of pathogenesis:

  • Oxidative Stress Resistance:

    • Macrophages generate reactive oxygen species (ROS) as a primary defense mechanism

    • YedZ contributes to bacterial survival within macrophages by reducing oxidized proteins damaged by these ROS

    • This may prevent bacterial killing during the initial oxidative burst phase

  • Impact on Macrophage Polarization:

    • Y. pseudotuberculosis can influence macrophage polarization toward the M2 phenotype

    • While not directly studied for YedZ, the protein may contribute to this process by enabling bacterial persistence in macrophages

    • M2 macrophages exhibit reduced microbicidal activity, potentially facilitating bacterial dissemination to the liver and other organs

  • Bacterial Survival in Phagocytes:

    • Y. pseudotuberculosis employs multiple mechanisms to survive within phagocytes

    • YedZ likely contributes to these survival strategies by maintaining protein function under oxidative stress conditions

    • This may allow the bacterium to establish persistent infections in lymphoid tissues and the liver

Understanding these interactions is essential for developing novel approaches to treat hepatic pathology during Y. pseudotuberculosis infection, as the bacterium's ability to modulate macrophage responses directly influences disease progression and severity .

How can YedZ be utilized in heterologous complementation studies?

Heterologous complementation studies involving YedZ can provide valuable insights into bacterial protein function conservation and specificity:

  • Experimental Design for Complementation Studies:

    • Generate a YedZ-deficient Y. pseudotuberculosis strain through precise gene deletion

    • Clone YedZ homologs from related bacteria into expression vectors with inducible promoters (e.g., IPTG-inducible pMMB67EHgm)

    • Introduce these constructs into the mutant strain via conjugation

    • Assess phenotype restoration using appropriate functional assays

  • Functional Conservation Analysis:

    • Based on studies with other Y. pseudotuberculosis proteins (e.g., YscX and YscY), heterologous complementation may reveal species-specific functionality

    • Analyze both structural conservation and functional outcomes to identify critical regions for activity

  • Dominant Negative Approach:

    • Express homologs in wild-type strains to identify potential dominant negative effects

    • This approach can reveal competitive interactions and binding partners

    • Absence of dominant negative effects may suggest lack of recognition by native systems

The methodological approach used for YscX and YscY studies provides a valuable template for YedZ research, though results may differ given the distinct functions of these proteins. Such studies could reveal whether YedZ function is strictly conserved among Yersinia species or if it displays functional plasticity across bacterial genera .

What are the challenges in studying the role of YedZ in bacterial sulfoxide reductase systems using recombinant proteins?

Studying recombinant YedZ in bacterial sulfoxide reductase systems presents several technical challenges that researchers must address:

  • Membrane Protein Reconstitution Issues:

    • YedZ is a membrane-associated protein requiring proper reconstitution to maintain native function

    • Challenges include achieving correct orientation in artificial membranes

    • Solution: Develop optimized reconstitution protocols using defined lipid compositions and controlled protein-to-lipid ratios

  • Heme Incorporation:

    • Complete functionality requires proper heme incorporation

    • Recombinant expression may result in variable heme occupancy

    • Solution: Supplement expression media with δ-aminolevulinic acid to enhance heme biosynthesis and incorporate heme verification steps in purification protocols

  • Maintaining Redox Partner Interactions:

    • YedZ functions as part of a multi-component electron transfer system

    • Studying isolated YedZ may not reflect physiological activity

    • Solution: Co-express and co-purify YedZ with its natural redox partners to preserve functional interactions

  • Assay Development Challenges:

    • Electron transfer activities can be difficult to monitor directly

    • Solution: Develop coupled assay systems that link electron transfer to measurable outputs such as substrate reduction or oxygen consumption

  • Stability During Storage:

    • Membrane proteins like YedZ can lose activity during storage

    • Solution: Optimize storage conditions with appropriate stabilizers (e.g., 6% trehalose) and avoid repeated freeze-thaw cycles

Addressing these challenges requires a multidisciplinary approach combining protein biochemistry, membrane biophysics, and enzymology techniques to obtain physiologically relevant insights into YedZ function .

How does YedZ compare structurally and functionally to homologous proteins in other bacterial pathogens?

A comparative analysis of YedZ across bacterial species reveals important evolutionary and functional relationships:

SpeciesProtein NameSequence Identity (%)Predicted Transmembrane DomainsHeme CoordinationKey Functional Differences
Y. pseudotuberculosis O:1bYedZ/MsrQ100 (reference)6His-HisReference structure
Y. pseudotuberculosis O:3YedZ/MsrQ99.56His-HisNearly identical function
Y. enterocoliticaYedZ/MsrQ91.26His-HisMinor variations in substrate specificity
E. coliYedZ/MsrQ83.76His-HisDifferent electron transfer kinetics
P. aeruginosaPA258045.36His-MetAltered redox potential
S. entericaYedZ/MsrQ84.26His-HisSimilar function to E. coli homolog

This comparison highlights that while the core structure of YedZ is conserved across bacterial species (particularly within the Enterobacteriaceae family), subtle variations exist that may influence electron transfer properties and substrate specificity. The high conservation within Yersinia species suggests evolutionary pressure to maintain this function for pathogenesis.

Unlike the Type III secretion system components like YscX and YscY, which show strict species-specific functionality, YedZ homologs may exhibit greater functional conservation across species due to their fundamental role in oxidative stress response .

What methodological approaches can determine if recombinant YedZ retains native conformational properties?

Verifying that recombinant YedZ maintains its native conformation is critical for ensuring experimental validity. Several methodological approaches can be employed:

  • Spectroscopic Analysis of Heme Environment:

    • UV-visible spectroscopy to confirm characteristic Soret band (~408 nm) and Q-bands (~530 and 560 nm)

    • Resonance Raman spectroscopy to analyze heme coordination state

    • Circular dichroism spectroscopy to assess secondary structure elements

  • Functional Assays:

    • Electron transfer rate measurements using artificial electron donors/acceptors

    • Coupling with partner proteins to verify physiological electron transfer pathways

    • Enzymatic activity assays measuring sulfoxide reduction in reconstituted systems

  • Structural Verification:

    • Limited proteolysis to assess protein folding (properly folded proteins show characteristic digestion patterns)

    • Thermal shift assays to determine stability profiles

    • Single-particle cryo-EM for membrane protein structure analysis

  • Binding Studies:

    • Isothermal titration calorimetry (ITC) to measure interaction with known binding partners

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • Fluorescence-based ligand binding assays

  • Membrane Incorporation Analysis:

    • Liposome flotation assays to verify membrane association

    • Proteoliposome freeze-fracture electron microscopy

    • Fluorescence quenching experiments to determine orientation in membranes

A comprehensive approach combining multiple techniques provides the strongest evidence for native-like structure and function of recombinant YedZ, enhancing confidence in subsequent experimental findings .

What storage conditions maintain optimal activity of purified recombinant YedZ protein?

Maintaining the activity of purified recombinant YedZ requires careful attention to storage conditions due to its membrane protein nature and heme-binding properties:

  • Recommended Storage Buffer:

    • Tris/PBS-based buffer (pH 8.0)

    • 6% Trehalose as a stabilizing agent

    • 0.05% mild detergent (e.g., DDM) to maintain solubility

    • Optional: 50% glycerol for freeze protection

  • Temperature Considerations:

    • Store at -20°C/-80°C for long-term storage

    • Working aliquots can be maintained at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles which significantly reduce activity

  • Aliquoting Strategy:

    • Create single-use aliquots immediately after purification

    • Use small volumes (50-100 μl) to minimize waste

    • Use air-tight, low-protein binding containers

  • Reconstitution Guidelines:

    • Reconstitute lyophilized protein in deionized sterile water

    • Aim for final concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol after reconstitution

  • Quality Control:

    • Verify protein integrity after storage using SDS-PAGE

    • Confirm heme content spectroscopically before use

    • Validate activity using standard electron transfer assays

Implementing these storage protocols can help maintain >90% of initial activity for up to 6 months, ensuring reliable experimental outcomes and reproducibility across studies .

What are the critical parameters for designing experiments to study YedZ in the context of bacterial pathogenesis?

Designing experiments to study YedZ's role in bacterial pathogenesis requires careful consideration of several critical parameters:

  • Genetic Manipulation Strategies:

    • Use precise allelic exchange to generate clean YedZ deletion mutants

    • Implement complementation with native and modified YedZ variants

    • Consider conditional expression systems to study timing-dependent effects

    • Design mutations targeting specific functional domains (heme-binding, membrane integration)

  • Infection Model Selection:

    • In vitro: Human/mouse macrophage cell lines for phagocyte interactions

    • Ex vivo: Liver tissue slices to study hepatic pathology

    • In vivo: Mouse models for pseudotuberculosis/FESLF progression

  • Oxidative Stress Parameters:

    • Standardize oxidative challenge conditions (H₂O₂, HOCl, NO donors)

    • Measure bacterial survival using colony forming unit (CFU) enumeration

    • Assess protein oxidation levels using OxyBlot or mass spectrometry

    • Monitor redox status using fluorescent redox sensors

  • Virulence Assessment Metrics:

    • Bacterial burden in tissues (liver, spleen, Peyer's patches)

    • Histopathological examination for tissue damage

    • Cytokine profiling to assess inflammatory responses

    • Survival analysis in animal models

  • Multi-omics Integration:

    • Transcriptomics to identify YedZ-dependent gene expression changes

    • Proteomics to assess global protein oxidation status

    • Metabolomics to evaluate metabolism alterations

By systematically controlling these parameters, researchers can dissect the specific contributions of YedZ to Y. pseudotuberculosis pathogenesis, particularly in the context of liver pathology where oxidative stress management is critical for bacterial persistence and disease progression .

What are the most promising approaches for developing inhibitors targeting YedZ function?

Developing inhibitors targeting YedZ function represents a potential avenue for novel antimicrobial therapeutics. The most promising approaches include:

  • Structure-Based Drug Design:

    • Utilize computational modeling of YedZ structure to identify potential binding pockets

    • Target the heme-binding site with competitive inhibitors

    • Design molecules that disrupt electron transfer pathways

    • Employ fragment-based screening approaches to identify initial hit compounds

  • High-Throughput Screening Strategies:

    • Develop fluorescence-based assays monitoring electron transfer activity

    • Implement whole-cell assays measuring YedZ-dependent bacterial survival under oxidative stress

    • Screen natural product libraries for compounds that interfere with heme incorporation

  • Peptide-Based Inhibitors:

    • Design peptides mimicking interaction surfaces between YedZ and partner proteins

    • Utilize phage display to identify peptides with high binding affinity

    • Engineer cell-penetrating peptides to improve cellular uptake

  • Allosteric Modulators:

    • Target regulatory sites that influence YedZ conformation

    • Develop compounds that lock the protein in inactive conformations

    • Identify small molecules that accelerate heme dissociation

  • Combined Approaches:

    • Target both YedZ and other components of the sulfoxide reductase system

    • Develop dual-action compounds affecting both YedZ and Type III secretion

    • Create sensitizing agents that make bacteria more vulnerable to oxidative killing

These approaches could lead to novel therapeutics for Yersinia infections, particularly those affecting the liver, where bacterial oxidative stress resistance is critical for pathogenesis .

How might advanced genetic engineering approaches be used to study YedZ structure-function relationships?

Advanced genetic engineering techniques offer powerful approaches to dissect YedZ structure-function relationships with unprecedented precision:

  • CRISPR-Cas9 Scanning Mutagenesis:

    • Systematically introduce point mutations across the YedZ gene

    • Create a comprehensive library of single amino acid variants

    • Screen for functional effects using high-throughput growth assays under oxidative stress

    • Map critical residues for heme binding, membrane integration, and partner protein interactions

  • Domain Swapping Experiments:

    • Engineer chimeric proteins combining domains from YedZ homologs across species

    • Test functionality using complementation assays in Y. pseudotuberculosis

    • Identify species-specific functional determinants

    • Assess the impact on pathogenesis in infection models

  • Directed Evolution Approaches:

    • Apply error-prone PCR to generate YedZ variant libraries

    • Select for enhanced function under specific conditions

    • Identify mutations that confer increased oxidative stress resistance

    • Analyze evolutionary trajectories and constraints

  • Site-Specific Incorporation of Unnatural Amino Acids:

    • Introduce spectroscopic probes at specific positions in YedZ

    • Incorporate crosslinkable amino acids to capture transient protein interactions

    • Engineer photo-activatable residues to control YedZ function with light

    • Create bioorthogonal handles for in situ labeling during infection

  • Conditional Degradation Systems:

    • Implement auxin-inducible or tetracycline-dependent degradation tags

    • Enable temporal control of YedZ levels during infection

    • Study kinetics of phenotypic changes upon YedZ depletion

    • Determine the critical window for YedZ function in pathogenesis

These cutting-edge approaches would significantly advance our understanding of how YedZ structure relates to its function in bacterial physiology and pathogenesis, potentially revealing new targets for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.