Recombinant Yersinia pseudotuberculosis serotype IB Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
arnC; YPTS_2404; Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase; Undecaprenyl-phosphate Ara4FN transferase; Ara4FN transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
arnC
Target Protein Sequence
MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIILVDDGSSDNSTELLTA AANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQNPPEEIPRLVHVAEEG YDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCMLRAYRRHIVEAMLHCHER STFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMYDLITCLTTTPLRLLSLVG SAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFIGAQFVGMGLLGEYIGRIYN DVRARPRYFVQKVVGAEQTENNQDVEK
Uniprot No.

Target Background

Function

This enzyme catalyzes the transfer of 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. This modified arabinose is incorporated into lipid A, contributing to resistance against polymyxins and cationic antimicrobial peptides.

Database Links
Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the catalytic function of Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) in Yersinia pseudotuberculosis?

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) catalyzes a critical reaction in lipopolysaccharide modification pathways. Specifically, it transfers 4-deoxy-4-formamido-L-arabinose from UDP to undecaprenyl phosphate. The complete reaction can be written as:

UDP-4-deoxy-4-formamido-beta-L-arabinose + di-trans,octa-cis-undecaprenyl phosphate → UDP + 4-deoxy-4-formamido-alpha-L-arabinose di-trans,octa-cis-undecaprenyl phosphate

This modified arabinose is subsequently attached to lipid A, a critical component of bacterial lipopolysaccharide (LPS). The addition of this arabinose group is essential for bacterial resistance to polymyxin antibiotics and other cationic antimicrobial peptides by reducing the negative charge of the bacterial outer membrane .

How does Yersinia pseudotuberculosis differ from related Yersinia species, and might this affect arnC function?

Yersinia pseudotuberculosis is a Gram-negative enteropathogen that causes gastrointestinal infections and can disseminate from the gut to mesenteric lymph nodes, spleen, and liver in infected hosts . While closely related to Yersinia pestis (which causes plague), these species exhibit distinct pathogenesis mechanisms despite sharing >97% identity in 75% of their chromosomal genes .

Y. pestis evolved from Y. pseudotuberculosis within the last 10,000 to 20,000 years , but they differ radically in their disease etiologies. Y. pseudotuberculosis typically causes a self-limiting gastrointestinal infection called yersiniosis, characterized by ileitis and mesenteric lymphadenitis , whereas Y. pestis causes the potentially fatal disease plague.

Research suggests that despite genetic similarity, expression of conserved regulatory elements (including small RNAs) differs between these species in both timing and dependence on regulatory factors like Hfq . This indicates that while arnC may be structurally similar between species, its regulation and thus its contribution to pathogenesis could vary significantly.

What expression systems are most effective for producing recombinant arnC from Y. pseudotuberculosis?

For successful expression of recombinant arnC from Y. pseudotuberculosis, consider these methodological approaches:

  • Bacterial Expression Systems:

    • E. coli BL21(DE3) with pET vectors containing optimized codons

    • C41/C43(DE3) strains specifically engineered for membrane protein expression

    • Cold-shock expression systems for temperature-sensitive proteins

  • Y. pseudotuberculosis-based Expression:

    • Homologous expression using the triple-mutant Y. pseudotuberculosis strain χ10069 (ΔyopK ΔyopJ Δasd) which has been engineered for protein delivery

    • Using the natural regulatory elements to ensure proper folding and processing

  • Optimization Parameters:

    • Expression temperature: 26°C for lower expression but potentially better folding

    • Induction strategies: Low IPTG concentrations (0.1-0.5 mM) or auto-induction media

    • Addition of membrane-like environments: detergents, lipids, or nanodiscs during purification

Since arnC is involved in LPS modification, which is a membrane-associated process, attention to membrane incorporation and proper folding is critical for obtaining functional protein. Consider fusion tags that enhance solubility (MBP, SUMO) or facilitate membrane association.

How can we effectively measure arnC enzymatic activity in vitro?

Measuring arnC enzymatic activity requires tracking either substrate utilization or product formation. Here are methodological approaches:

  • Radiometric Assays:

    • Use [14C] or [3H]-labeled UDP-4-deoxy-4-formamido-L-arabinose

    • Measure transfer of radiolabel to lipid phase (undecaprenyl phosphate)

    • Separate phases using organic extraction and quantify by scintillation counting

  • HPLC/LC-MS Based Assays:

    • Monitor disappearance of UDP-4-deoxy-4-formamido-L-arabinose

    • Detect formation of modified undecaprenyl phosphate

    • Quantify released UDP as a reaction product

  • Coupled Enzyme Assays:

    • Link UDP release to NADH oxidation via pyruvate kinase and lactate dehydrogenase

    • Monitor absorbance decrease at 340 nm

    • Calculate enzyme activity based on stoichiometric relationship

  • In vivo Functional Complementation:

    • Use arnC-deficient bacterial strains with polymyxin sensitivity

    • Complement with recombinant Y. pseudotuberculosis arnC

    • Measure restoration of polymyxin resistance as functional readout

Assay TypeAdvantagesLimitationsDetection Limit
RadiometricHigh sensitivity, direct measurementRequires radioactive materials, specialized disposal~10-100 pmol
HPLC/LC-MSAccurate, identifies specific productsExpensive equipment, complex method development~1-10 nmol
Coupled EnzymeContinuous monitoring, no specialized equipmentPotential interference from sample components~0.1-1 μmol
Functional ComplementationMeasures biologically relevant activityQualitative rather than quantitativeN/A

How does arnC contribute to polymyxin resistance in Y. pseudotuberculosis, and what experimental approaches can verify this relationship?

ArnC plays a critical role in polymyxin resistance through LPS modification. To experimentally validate this relationship:

  • Gene Knockout Studies:

    • Generate precise arnC deletion mutants using CRISPR-Cas9 or allelic exchange

    • Perform minimum inhibitory concentration (MIC) testing with polymyxin

    • Compare survival rates between wild-type and ΔarnC strains under polymyxin challenge

  • Biochemical Analysis of LPS:

    • Extract LPS from wild-type and mutant strains

    • Analyze structural modifications using mass spectrometry

    • Quantify 4-deoxy-4-formamido-L-arabinose incorporation into lipid A

  • Complementation Studies:

    • Reintroduce functional arnC on a plasmid into the knockout strain

    • Assess restoration of polymyxin resistance

    • Create point mutations in catalytic residues to identify essential amino acids

  • Expression Analysis Under Antimicrobial Pressure:

    • Expose bacteria to sub-lethal polymyxin concentrations

    • Measure arnC expression using qRT-PCR or RNA-seq

    • Correlate expression levels with resistance phenotypes

Research has demonstrated that modifications to lipid A are required for resistance to polymyxin and cationic antimicrobial peptides . When Y. pseudotuberculosis encounters these compounds, the addition of 4-deoxy-4-formamido-L-arabinose to lipid A reduces the negative charge of the bacterial outer membrane, thereby decreasing binding affinity of cationic antimicrobials and enhancing bacterial survival.

What regulatory systems control arnC expression in response to environmental signals in Y. pseudotuberculosis?

While specific information about arnC regulation in Y. pseudotuberculosis is limited in the search results, we can infer potential regulatory mechanisms based on related systems and available data:

  • Two-Component Regulatory Systems:

    • The CpxA sensor kinase and CpxR response regulator system likely plays a role, as it detects cell envelope damage and regulates factors for envelope integrity restoration

    • PhoP/PhoQ and PmrA/PmrB systems typically regulate LPS modification genes in response to environmental signals in related bacteria

  • Environmental Signals That May Trigger Expression:

    • Magnesium limitation (sensed by PhoQ)

    • Acidic pH encountered during host infection

    • Presence of antimicrobial peptides

    • Cell envelope stress detected by the Cpx system

  • Experimental Approaches for Regulatory Studies:

    • Promoter-reporter fusions (luciferase, GFP) to monitor arnC expression

    • ChIP-seq to identify transcription factor binding sites

    • RNA-seq under various environmental conditions

    • Construction of regulatory protein mutants to assess impact on arnC expression

The regulation of arnC likely involves complex integration of multiple signals to ensure appropriate LPS modification in response to specific environmental challenges, particularly those encountered during host infection.

What are the critical structural features of arnC that enable its catalytic function?

Based on available information and knowledge of related glycosyltransferases:

  • Conserved Domains and Motifs:

    • ArnC belongs to the glycosyltransferase family, which typically contains a DXD motif for metal ion coordination

    • The protein sequence (from search result ) contains key regions for substrate binding and catalysis

    • A membrane-association domain is likely present to facilitate interaction with the lipid substrate

  • Structural Requirements for Catalysis:

    • A binding pocket for the UDP-sugar donor substrate

    • A hydrophobic region for interaction with the undecaprenyl phosphate acceptor

    • Specific residues for transition state stabilization during glycosyl transfer

  • Experimental Approaches to Determine Structure-Function:

    • Site-directed mutagenesis of predicted catalytic residues

    • Protein truncation experiments to identify minimal functional domains

    • X-ray crystallography or cryo-EM structure determination

    • Molecular dynamics simulations to investigate substrate binding

How does the membrane association of arnC influence its activity and substrate accessibility?

As a membrane-associated enzyme that transfers a sugar from a cytoplasmic UDP-sugar to a membrane-embedded lipid carrier, arnC must operate at the interface between aqueous and lipid environments:

  • Membrane Topology Considerations:

    • The C-terminal hydrophobic regions likely anchor the protein to the cytoplasmic face of the inner membrane

    • The catalytic domain must be positioned to access both the water-soluble UDP-sugar and the membrane-embedded undecaprenyl phosphate

    • A potential "tunnel" or groove might facilitate substrate presentation at the interface

  • Lipid Environment Effects:

    • Membrane composition can affect enzyme activity through direct interactions

    • Lipid bilayer properties (fluidity, thickness) may influence substrate accessibility

    • Local membrane curvature could play a role in optimizing enzyme-substrate interactions

  • Methodological Approaches for Investigation:

    • Reconstitution in liposomes of varying composition

    • Fluorescence resonance energy transfer (FRET) to measure substrate binding dynamics

    • Atomic force microscopy to visualize membrane association

    • Hydrogen-deuterium exchange mass spectrometry to identify membrane-interacting regions

  • Research Implications:

    • Understanding membrane association is crucial for developing inhibitors that can access the active site

    • Reconstitution conditions will significantly impact in vitro activity measurements

    • Protein engineering efforts must preserve membrane interaction capabilities

How does arnC-mediated LPS modification affect Y. pseudotuberculosis interactions with host immune cells?

The modification of LPS by arnC has significant implications for host-pathogen interactions:

  • Effects on Innate Immune Recognition:

    • Modified LPS may alter recognition by pattern recognition receptors, particularly Toll-like receptor 4 (TLR4)

    • Changes in LPS structure can affect activation of the complement cascade

    • Cationic antimicrobial peptide resistance provides protection against host defense molecules

  • Impact on Phagocyte Interactions:

    • Y. pseudotuberculosis interactions with dendritic cells involve CD209 receptors, which recognize LPS components

    • LPS modifications may influence bacterial uptake and survival within phagocytes

    • Research indicates Y. pseudotuberculosis can exploit CD209 receptors for dissemination

  • Experimental Evidence:

    • Y. pseudotuberculosis expresses various anti-phagocytic factors, including plasmid-encoded Yersinia outer proteins and chromosome-encoded protein toxins

    • These factors contribute to bacterial colonization of lymphoid organs through effects on immune cells

    • LPS core structures play a role in bacterial recognition and uptake by immune cells

  • Research Approaches:

    • Compare wild-type and arnC mutant interactions with macrophages and dendritic cells

    • Measure cytokine production in response to different bacterial strains

    • Assess phagocytosis rates and intracellular survival

    • Examine dendritic cell activation and antigen presentation

What is the relationship between arnC activity and Y. pseudotuberculosis dissemination from the intestine to lymphoid tissues?

Y. pseudotuberculosis dissemination from the intestine to mesenteric lymph nodes (MLNs) is a hallmark of infection . While arnC's specific role isn't directly addressed in the search results, we can analyze potential connections:

  • Dissemination Mechanisms:

    • Y. pseudotuberculosis disseminates to MLNs directly from the intestinal lumen

    • CD209 receptors on dendritic cells contribute to this dissemination process

    • LPS structure influences interactions with these receptors

  • Potential Role of arnC:

    • LPS modifications affect bacterial survival in antimicrobial environments of the gut

    • Changes in surface charge may influence interactions with epithelial and immune cells

    • Resistance to antimicrobial peptides could enhance survival during tissue migration

  • Experimental Questions to Address:

    • Is arnC expression upregulated during intestinal colonization or dissemination?

    • Do arnC mutants show altered ability to reach mesenteric lymph nodes?

    • How does LPS modification affect interaction with CD209-expressing cells?

    • Does arnC activity differ in bacteria isolated from different host tissues?

  • Research Design for Investigation:

    • In vivo competition assays between wild-type and arnC mutants

    • Tracking of bacterial dissemination using reporter strains

    • Ex vivo analysis of bacteria recovered from different tissues

    • Transcriptional profiling during different infection stages

How can arnC be exploited as a target for novel antimicrobial development?

ArnC represents a promising antimicrobial target due to its role in polymyxin resistance and absence in mammalian cells:

  • Target Validation Approaches:

    • Confirm essentiality or significant contribution to virulence in vivo

    • Demonstrate that inhibition sensitizes bacteria to host defense mechanisms

    • Establish structural and biochemical basis for inhibitor design

  • Potential Inhibition Strategies:

    • Competitive inhibitors of UDP-sugar binding

    • Allosteric inhibitors that disrupt enzyme conformation

    • Compounds that interfere with membrane association

    • Inhibitors of arnC expression or regulatory pathways

  • Drug Development Pipeline:

    • High-throughput screening using activity assays

    • Fragment-based drug discovery targeting specific protein domains

    • Structure-based design using computational approaches

    • Whole-cell screening for compounds that sensitize to polymyxins

  • Advantages and Challenges:

AdvantagesChallenges
Not present in mammalsMembrane-associated target may be difficult to access
Sensitizes bacteria to existing antimicrobialsComplex substrates complicate assay development
May reduce emergence of polymyxin resistanceMay require co-administration with polymyxins
Could target multiple Gram-negative pathogensPotential for resistance through alternative pathways
  • Broader Implications:

    • Targeting arnC could preserve the efficacy of polymyxins, which are often last-resort antibiotics

    • Inhibitors could potentially work against multiple species since LPS modification is a conserved resistance mechanism

    • Combination therapies with arnC inhibitors and existing antimicrobials could enhance treatment efficacy

What role might small RNAs play in regulating arnC expression during Y. pseudotuberculosis infection?

The regulation of virulence factors in Y. pseudotuberculosis involves complex networks including small RNAs (sRNAs):

  • Evidence for sRNA Regulation:

    • Research has identified 150 unannotated sRNAs in Y. pseudotuberculosis

    • The RNA chaperone Hfq is required for full virulence, suggesting important roles for sRNAs

    • Expression of many sRNAs differs between Y. pseudotuberculosis and Y. pestis, indicating evolved regulatory differences

  • Potential Mechanisms of Regulation:

    • Direct base-pairing between sRNAs and arnC mRNA affecting translation or stability

    • Indirect regulation through sRNA effects on transcription factors controlling arnC

    • sRNA-mediated responses to environmental signals encountered during infection

  • Experimental Approaches:

    • RNA-seq analysis under conditions that induce arnC expression

    • sRNA deletion libraries screened for altered polymyxin resistance

    • In vitro RNA binding assays to identify direct interactions

    • Proteomics analysis of sRNA mutants to detect changes in ArnC levels

  • Research Design Example:

    • Generate reporter fusions to monitor arnC expression

    • Screen a library of sRNA deletion mutants for altered reporter activity

    • Validate direct interactions using biochemical methods

    • Assess impact on polymyxin resistance and virulence

The study of sRNA regulation of arnC could reveal novel regulatory mechanisms and potentially identify new targets for antimicrobial development that disrupt this regulation.

How does arnC from Y. pseudotuberculosis compare with homologs in other bacterial pathogens?

A comparative analysis of arnC across bacterial species provides insights into evolutionary adaptations and functional conservation:

  • Sequence and Structural Comparison:

    • The arnC gene is part of the arn operon (sometimes called pmr operon) in many Gram-negative bacteria

    • Sequence conservation is typically high in catalytic domains but may vary in regulatory or membrane-association regions

    • Structural adaptations may reflect differences in LPS architecture between species

  • Functional Differences:

    • Substrate specificity may vary between species with different LPS modifications

    • Regulatory mechanisms controlling expression likely evolved to suit specific ecological niches

    • The contribution to virulence may differ based on host-pathogen interaction patterns

  • Cross-Species Findings:

    • In Escherichia coli, arnC (EC 2.4.2.53) catalyzes the same reaction as in Yersinia

    • The enzyme contributes to polymyxin resistance across multiple Gram-negative species

    • Gene organization within the arn operon may differ between species

  • Evolutionary Implications:

    • Conservation of arnC between Y. pseudotuberculosis and Y. pestis despite their recent divergence suggests its fundamental importance

    • Variations in regulatory elements may reflect adaptation to different infection strategies

    • Horizontal gene transfer may have played a role in disseminating resistance mechanisms

  • Research Approaches:

    • Phylogenetic analysis across bacterial species

    • Functional complementation studies between species

    • Structural biology approaches to compare enzyme architectures

    • Regulatory network mapping in different bacterial backgrounds

Understanding these similarities and differences has implications for broad-spectrum antimicrobial development and evolutionary studies of antibiotic resistance mechanisms.

What are the current methodological challenges in studying recombinant arnC, and how can they be addressed?

Working with recombinant arnC presents several technical challenges:

  • Protein Solubility and Stability Issues:

    • Challenge: ArnC is membrane-associated, making it difficult to produce in soluble, active form

    • Solutions:

      • Screen multiple detergents and solubilization conditions

      • Use fusion partners that enhance solubility (MBP, SUMO, Trx)

      • Express in membrane mimetic environments (nanodiscs, liposomes)

      • Employ cell-free expression systems with added lipids

  • Substrate Availability:

    • Challenge: The substrates (UDP-4-deoxy-4-formamido-L-arabinose and undecaprenyl phosphate) are not commercially available

    • Solutions:

      • Chemical synthesis of substrates or stable analogs

      • Enzymatic generation of substrates using upstream pathway enzymes

      • Development of alternative substrates for initial screening

      • Collaboration with specialized chemical synthesis laboratories

  • Activity Assay Development:

    • Challenge: Direct activity measurement requires separation of lipid and aqueous phases

    • Solutions:

      • Develop coupled enzyme assays that monitor UDP release

      • Create fluorescent or radioactive substrate analogs

      • Implement LC-MS methods for direct product detection

      • Use surrogate readouts like polymyxin resistance in complementation assays

  • Structural Studies:

    • Challenge: Membrane proteins are notoriously difficult for crystallography

    • Solutions:

      • Cryo-EM for structure determination without crystallization

      • NMR studies of specific domains or with detergent solubilization

      • Computational modeling based on homologous proteins

      • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • In Vivo Functional Analysis:

    • Challenge: Creating clean genetic modifications without polar effects

    • Solutions:

      • CRISPR-Cas9 genome editing for precise modifications

      • Complementation with wild-type gene to confirm phenotype specificity

      • Inducible expression systems for temporal control

      • Site-specific recombination for scarless mutagenesis

By addressing these technical challenges, researchers can develop a more comprehensive understanding of arnC function and its potential as an antimicrobial target.

How can systems biology approaches enhance our understanding of arnC function in the context of Y. pseudotuberculosis pathogenesis?

Integrating multiple data types can provide a comprehensive view of arnC's role:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data to understand how arnC fits into broader cellular networks

    • Correlate LPS modification patterns with gene expression changes

    • Link arnC activity to global cellular responses during infection

  • Network Analysis Approaches:

    • Construct regulatory networks involving arnC and related genes

    • Identify key hubs that control LPS modification in response to environmental signals

    • Map interactions between arnC and virulence factor regulatory networks

  • Computational Modeling:

    • Develop kinetic models of LPS modification pathways

    • Simulate effects of environmental changes on pathway activity

    • Predict consequences of targeted interventions

  • Data Integration Table Example:

Data TypeInformation ProvidedIntegration Benefit
TranscriptomicsExpression patterns of arnC and related genesIdentifies co-regulated genes and regulatory relationships
ProteomicsArnC protein levels and post-translational modificationsReveals discrepancies between transcript and protein levels
MetabolomicsLPS modification profilesConnects enzyme activity to actual cellular outcomes
GenomicsGenetic variants in clinical isolatesLinks sequence variations to functional differences
Host ResponseImmune recognition of modified vs. unmodified LPSContextualizes bacterial adaptation within host interaction
  • Research Applications:

    • Predict antibiotic resistance emergence mechanisms

    • Identify critical nodes for therapeutic targeting

    • Understand compensatory mechanisms when arnC is inhibited

    • Model bacterial adaptation to host environments

Systems biology approaches can reveal emergent properties not apparent from reductionist studies and provide a framework for understanding arnC's role in the complex process of bacterial pathogenesis.

What emerging technologies and approaches will advance our understanding of arnC function and its therapeutic targeting?

Several cutting-edge approaches show promise for future research:

  • CRISPR Interference Technologies:

    • CRISPRi for titratable gene repression without complete knockout

    • CRISPR-based screens to identify genetic interactions with arnC

    • Base editing for precise amino acid substitutions in the native locus

  • Single-Cell Technologies:

    • Single-cell RNA-seq to examine heterogeneity in arnC expression

    • Microfluidics-based approaches to track individual bacterial responses

    • Time-lapse microscopy with reporter systems to visualize dynamics

  • Structural Biology Advances:

    • Cryo-EM for membrane protein structures without crystallization

    • Integrative structural biology combining multiple experimental data types

    • AI-driven structure prediction using tools like AlphaFold2

  • Synthetic Biology Approaches:

    • Reconstitution of minimal LPS modification systems in liposomes

    • Creation of biosensors to monitor enzyme activity in real-time

    • Engineering orthogonal systems to probe mechanism without interference

  • Translational Research Opportunities:

    • High-throughput screening platforms for inhibitor discovery

    • Development of PROTACs or molecular glues for protein degradation

    • Combination approaches targeting multiple LPS modification enzymes

    • Structure-based design of transition state analogs

  • Host-Pathogen Interface Studies:

    • Organoid models to study interactions in physiologically relevant systems

    • Immune cell co-culture systems to assess host response to LPS variants

    • In vivo imaging to track infection dynamics with labeled bacteria

  • Research Priorities Table:

Research AreaPriority QuestionsTechnological Approaches
Structural MechanismHow does arnC bind and position its substrates?Cryo-EM, MD simulations, HDX-MS
RegulationWhat signals modulate arnC expression during infection?RNA-seq, ChIP-seq, reporter assays
Host InteractionHow do LPS modifications affect immune recognition?Organoids, immune cell assays, cytokine profiling
Drug DevelopmentCan specific inhibitors be designed based on structure?Fragment screening, in silico design, SAR studies
Systems IntegrationHow does arnC function coordinate with other resistance mechanisms?Multi-omics, network analysis, mathematical modeling

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.