Recombinant Yersinia pseudotuberculosis serotype IB Universal stress protein B (uspB)

Shipped with Ice Packs
In Stock

Description

Compound Overview

Recombinant Yersinia pseudotuberculosis serotype IB Universal Stress Protein B (uspB) refers to a bioengineered form of the uspB gene product from Y. pseudotuberculosis serotype IB. Universal stress proteins (USPs) are evolutionarily conserved bacterial proteins that protect cells under stress conditions (e.g., nutrient deprivation, oxidative stress). While uspB has been studied in Y. pestis and other Yersinia species, direct references to serotype IB Y. pseudotuberculosis remain limited.

Serotype-Specific Variability in Y. pseudotuberculosis

Y. pseudotuberculosis exhibits serotype diversity, with strains categorized into O:1a, O:1b, O:2a, O:2b, O:13, etc. . Serotype IB is not explicitly documented in the literature, suggesting potential confusion with Y. pestis serotypes (e.g., serovars like EV76, EV78). For example:

  • Serotype O:1b (common in Europe) carries the high-pathogenicity island (HPI) encoding yersiniabactin .

  • Serotype O:2a is linked to septicemia in hares but lacks HPI .

Expression and Purification

Recombinant uspB from Y. pestis bv. Antiqua is expressed in E. coli and purified via His-tag affinity chromatography . Key specifications include:

ParameterDetailsSource
HostE. coli
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
StabilityAvoid repeated freeze-thaw cycles; store at -20°C/-80°C

Potential Roles in Pathogenesis

While uspB’s direct role in Y. pseudotuberculosis remains uncharacterized, USPs in other pathogens:

  • Stress Response: Mitigate oxidative stress, nutrient deprivation .

  • Immune Evasion: Indirectly aid survival during host colonization .

Comparative Analysis of Yersinia Stress Proteins

ProteinSpeciesFunctionVirulence AssociationSources
uspBY. pestisStress adaptationLimited data
YopEY. pseudotuberculosisInhibits phagocytosis via Rho GTPase manipulationCritical for infection
CpxR~PY. pseudotuberculosisRepresses rovA (virulence regulator)Modulates pathogenicity

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uspB; YPTS_4025; Universal stress protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
uspB
Target Protein Sequence
MISTVALFWALCVVCVVNMARYYSSLRALLVVLRGCDPLLYQYVDGGGFFTSHGQPSKQI RLVGYIFAQRYLDHHDPEFIRRCERLRGQFILTSALCGLVVVSLVALMLWY
Uniprot No.

Target Background

Database Links
Protein Families
Universal stress protein B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis and why is it important in research?

Yersinia pseudotuberculosis is a Gram-negative enteric pathogen that serves as a significant model organism in pathogenicity studies. As an environmental bacterium, it provides valuable insights into bacterial adaptation, virulence mechanisms, and host-pathogen interactions. Its importance stems from its close genetic relationship to Yersinia pestis (the causative agent of plague), with approximately 97% DNA sequence identity between these species . This genetic similarity makes Y. pseudotuberculosis an excellent model for studying bacterial evolution and adaptation while working with a less virulent organism than Y. pestis, which is classified as a potential bioterrorism agent and requires specialized containment facilities .

What are the primary virulence factors in Y. pseudotuberculosis, and how do they relate to Universal stress protein B?

Y. pseudotuberculosis possesses several key virulence factors, including type III secretion systems that inject effector proteins directly into host cells. For serotype IB strains specifically, the pathogen utilizes specialized secretion systems like the Ysc-Yop system, which operates at 37°C (human body temperature) . Universal stress protein B (uspB) is part of the bacterial stress response system that enables adaptation to environmental changes and stressors. While not directly mentioned in the search results, uspB likely contributes to the pathogen's ability to survive under stress conditions, potentially working in concert with other regulatory systems like Zur, which has been documented to function as a global regulator affecting metal homeostasis, motility, biofilm formation, and stress resistance .

How does the serotyping system for Y. pseudotuberculosis work, and what distinguishes serotype IB?

Y. pseudotuberculosis serotyping is based on specific polysaccharide structures, similar to other Gram-negative bacteria. While the search results don't explicitly detail the Y. pseudotuberculosis serotyping system, we can draw parallels from similar systems like those used for group B streptococcus (GBS), where serotyping is conducted via latex agglutination and serotype-specific PCR methods for non-typeable isolates . Serotype IB in Y. pseudotuberculosis is distinguished by specific O-antigen structures on the lipopolysaccharide layer of the bacterial outer membrane. This serotype classification is crucial for epidemiological studies, vaccine development, and understanding strain-specific virulence characteristics.

What are the optimal conditions for culturing recombinant Y. pseudotuberculosis expressing uspB, and how should growth be monitored?

Optimal culturing conditions for recombinant Y. pseudotuberculosis strains typically involve growth at 26°C for standard laboratory maintenance, with a shift to 37°C to induce expression of temperature-regulated virulence factors. Based on research with similar recombinant strains, researchers should use rich media such as Luria-Bertani (LB) broth supplemented with appropriate antibiotics to maintain plasmid selection .

For monitoring growth, spectrophotometric measurements at OD600 are recommended, with sampling every 2-3 hours to generate accurate growth curves. When specifically studying uspB expression, researchers should consider using minimal media with controlled stress conditions (oxidative stress, nutrient limitation, pH changes) to induce the universal stress response. Growth monitoring should be complemented with protein expression analysis using Western blotting with anti-uspB antibodies or quantitative PCR to measure uspB transcript levels under various conditions .

What methodologies are recommended for genetic modification of Y. pseudotuberculosis to create recombinant strains expressing uspB?

For generating recombinant Y. pseudotuberculosis strains expressing uspB, researchers have successfully employed several approaches:

  • Plasmid-based expression: Using Asd+ plasmids similar to pSMV13, which has been effectively used for expression of Y. pestis antigens in Y. pseudotuberculosis . This approach allows for controlled, high-level expression of the target protein.

  • Chromosomal integration: For more stable expression without antibiotic selection, chromosome insertion techniques can be employed. This approach has been successfully used to insert the caf1R-caf1A-caf1M-caf1 operon into Y. pseudotuberculosis . For uspB expression, lambda Red recombination or CRISPR-Cas9 systems could be adapted for precise genomic integration.

  • Inducible expression systems: Temperature-sensitive or chemically inducible promoters can be used to control uspB expression, allowing researchers to study the protein's function under specific conditions.

Each approach requires careful consideration of codon optimization, promoter strength, and potential metabolic burden on the bacterial host to ensure stable, functional expression of the uspB protein .

What functional assays are most appropriate for characterizing the role of uspB in stress response mechanisms of Y. pseudotuberculosis?

To characterize the role of uspB in stress response mechanisms, researchers should implement a multi-faceted approach:

  • Survival assays under various stressors: Compare wild-type and uspB mutant strains under oxidative stress (H₂O₂ exposure), acid stress (pH 4.5-5.5), nutrient limitation, and antimicrobial challenge. Quantify survival rates through colony-forming unit (CFU) counts at defined time points .

  • Transcriptomic analysis: RNA-seq comparison between wild-type and ΔuspB mutant strains under normal and stress conditions can identify genes differentially regulated by uspB, providing insights into its regulatory network. This approach has been successfully used to characterize the Zur regulon in Y. pseudotuberculosis .

  • Protein interaction studies: Co-immunoprecipitation followed by mass spectrometry can identify protein partners interacting with uspB during stress responses.

  • Biofilm formation assays: Given the importance of biofilm formation in bacterial persistence, crystal violet staining assays should be used to quantify biofilm formation capacity in wild-type versus uspB mutant strains, similar to studies on Zur's role in Y. pseudotuberculosis biofilm formation .

  • Motility assays: Swimming and swarming motility tests on semi-solid agar can determine if uspB affects bacterial motility, a key virulence trait .

How does uspB contribute to Y. pseudotuberculosis metal homeostasis and what techniques can best elucidate these relationships?

While the search results don't explicitly connect uspB to metal homeostasis, we can extrapolate from studies on similar stress-response proteins like Zur in Y. pseudotuberculosis. To investigate potential roles of uspB in metal homeostasis, researchers should consider:

  • Metal sensitivity assays: Compare growth of wild-type and uspB mutant strains in media supplemented with various concentrations of zinc, iron, copper, and magnesium to identify metal-specific phenotypes .

  • Metal uptake measurements: Use inductively coupled plasma mass spectrometry (ICP-MS) to quantify intracellular metal concentrations in wild-type versus uspB mutant strains under various growth conditions.

  • Metal-responsive promoter reporter assays: Construct reporter fusions with promoters of known metal transporters and regulators to determine if uspB affects their expression.

  • Protein-DNA interaction studies: Employ electrophoretic mobility shift assays (EMSA) to determine if uspB binds directly to promoters of metal homeostasis genes, similar to how Zur has been shown to directly bind to promoters of transport system genes .

  • Structural studies: X-ray crystallography or cryo-electron microscopy of uspB in the presence and absence of various metals can provide insights into potential metal binding sites and conformational changes.

What are the most promising strategies for utilizing recombinant Y. pseudotuberculosis expressing uspB in vaccine development against Y. pestis?

Developing recombinant Y. pseudotuberculosis strains as vaccine candidates against Y. pestis has shown considerable promise. Strategies for incorporating uspB into such vaccine development include:

  • Outer membrane vesicle (OMV) platforms: Research has demonstrated that OMVs from recombinant Y. pseudotuberculosis strains can enclose multiple immunogens and provide self-adjuvanting properties. Incorporating uspB into such OMV-based vaccines could enhance stress resistance and immunogenicity. OMVs from recombinant Y. pseudotuberculosis have shown superior protection compared to subunit vaccines against Y. pestis challenges .

  • Attenuated live vaccine development: Creating attenuated Y. pseudotuberculosis strains with modified uspB expression could enhance vaccine safety while maintaining immunogenicity. Research has shown that oral administration of recombinant attenuated Y. pseudotuberculosis expressing Y. pestis antigens provided 70-90% protection against lethal Y. pestis challenges in mice .

  • Multi-antigen approaches: Combining uspB with established protective antigens like F1 and LcrV could broaden immune responses against Y. pestis. This approach may be particularly valuable as uspB is likely conserved across Yersinia species and may provide cross-protection against multiple strains .

  • Temperature-regulated expression systems: Designing vaccine strains with temperature-dependent expression of uspB and other antigens can ensure optimal immunogen production in vivo while maintaining strain stability during manufacturing .

How can transcriptomic and proteomic analyses be optimized to understand the global regulatory network involving uspB in Y. pseudotuberculosis?

To comprehensively characterize the global regulatory network involving uspB in Y. pseudotuberculosis, researchers should implement an integrated multi-omics approach:

  • RNA-seq with optimized conditions: Compare transcriptomes of wild-type and uspB knockout strains under various stress conditions (oxidative, acid, nutrient limitation) with biological triplicates. Include time-course sampling to capture dynamic responses. This approach successfully revealed Zur's global regulatory functions across multiple functional categories in Y. pseudotuberculosis .

  • Chromatin immunoprecipitation sequencing (ChIP-seq): Identify direct binding sites of uspB (if it has DNA-binding capabilities) or transcription factors regulated by uspB across the genome.

  • Proteomics with quantitative MS/MS: Use stable isotope labeling with amino acids in cell culture (SILAC) or tandem mass tag (TMT) labeling for accurate quantification of protein-level changes between wild-type and uspB mutant strains.

  • Post-translational modification analysis: Phosphoproteomics and other PTM analyses can reveal how uspB affects signaling networks and protein function beyond transcriptional control.

  • Metabolomics: Integrate metabolite profiles to understand how uspB influences bacterial metabolism under stress conditions.

  • Network analysis: Apply computational approaches to integrate multi-omics data and construct comprehensive regulatory networks, identifying direct and indirect targets of uspB regulation .

What animal models are most appropriate for studying Y. pseudotuberculosis serotype IB infections, and how should uspB expression be monitored in vivo?

For studying Y. pseudotuberculosis serotype IB infections and monitoring uspB expression in vivo, researchers should consider the following models and approaches:

How does uspB expression in Y. pseudotuberculosis influence interactions with the host immune system?

Understanding how uspB expression influences host-pathogen interactions requires detailed immunological studies:

  • Innate immune response analysis: Compare innate immune activation between wild-type and uspB mutant infections by measuring:

    • Neutrophil and macrophage recruitment to infection sites

    • Cytokine/chemokine profiles (IL-1β, TNF-α, IL-6, IL-8)

    • Activation of pattern recognition receptors (TLRs, NLRs)

    • Reactive oxygen species production by phagocytes

  • Adaptive immunity studies: Evaluate T-cell and antibody responses specific to uspB and other Y. pseudotuberculosis antigens following infection or immunization with recombinant strains. Similar approaches have been used to characterize immune responses to F1 antigen in recombinant Y. pseudotuberculosis vaccine models .

  • Immune evasion mechanisms: Investigate whether uspB contributes to immune evasion through:

    • Resistance to complement-mediated killing

    • Survival within macrophages

    • Modulation of inflammatory signaling pathways

    • Interference with antigen presentation

  • Comparative immunoprofiling: Use flow cytometry, cytokine arrays, and transcriptomics of host cells to create comprehensive immunoprofiles comparing responses to wild-type and uspB mutant strains .

What statistical approaches are most appropriate for analyzing differential expression of uspB under various stress conditions?

For robust statistical analysis of uspB differential expression under various stress conditions, researchers should implement:

How should researchers design experiments to investigate potential contradictions in uspB function across different Y. pseudotuberculosis strains?

When investigating potential strain-specific differences in uspB function, researchers should implement a systematic experimental design that accounts for genetic diversity:

  • Strain selection strategy:

    • Include representative strains from different serotypes (particularly serotype IB)

    • Consider including clinical isolates and environmental strains

    • Include reference laboratory strains for comparability with existing literature

    • Perform whole-genome sequencing to identify genetic differences between strains

  • Experimental approach:

    • Create isogenic uspB mutants in multiple strain backgrounds using identical methodology

    • Perform parallel phenotypic assays under identical conditions

    • Use complementation with the same uspB allele across different strain backgrounds

    • Include appropriate controls for each strain background

  • Discrepancy resolution:

    • When contradictory results are observed, systematically investigate genetic factors:

      • Sequence the uspB locus and surrounding regions in all strains

      • Perform transcriptomic analysis to identify strain-specific regulatory networks

      • Use allelic exchange experiments (swap uspB alleles between strains)

      • Consider epistatic interactions through construction of double mutants

  • Data integration:

    • Develop a unified model that accounts for strain-specific differences

    • Identify core uspB functions conserved across strains versus strain-specific roles

    • Use comparative genomics to correlate genetic differences with functional variation

What are the most promising applications of CRISPR-Cas9 technology for studying uspB function in Y. pseudotuberculosis?

CRISPR-Cas9 technology offers powerful approaches for investigating uspB function in Y. pseudotuberculosis:

  • Precise genetic manipulation:

    • Create clean deletions without antibiotic resistance markers

    • Generate point mutations to study specific functional domains of uspB

    • Develop inducible CRISPR interference (CRISPRi) systems for conditional knockdown of uspB expression

    • Create uspB variants with epitope tags for protein localization and interaction studies

  • High-throughput functional genomics:

    • Perform CRISPR screening to identify genetic interactions with uspB

    • Create libraries of uspB variants to map structure-function relationships

    • Conduct parallel mutational analysis of uspB and related stress response genes

  • In vivo applications:

    • Develop CRISPR-based systems for tracking uspB expression during infection

    • Create conditional mutants that lose uspB function during specific infection stages

    • Generate fluorescently-tagged uspB for real-time visualization in infection models

  • Therapeutic and vaccine applications:

    • Engineer optimized Y. pseudotuberculosis vaccine strains with precisely tuned uspB expression

    • Create attenuated strains with specific uspB modifications that maintain immunogenicity

    • Develop CRISPR-based antimicrobials targeting uspB or related stress response systems

How might computational modeling and systems biology approaches advance our understanding of uspB's role in Y. pseudotuberculosis stress response networks?

Computational and systems biology approaches offer powerful tools for understanding the complex role of uspB in stress response networks:

  • Network modeling approaches:

    • Construct gene regulatory networks integrating transcriptomic and ChIP-seq data

    • Develop protein-protein interaction networks centered on uspB

    • Create metabolic models that incorporate stress response mechanisms

    • Develop dynamic models of uspB regulation under varying environmental conditions

  • Structural biology integration:

    • Perform molecular dynamics simulations of uspB under different stress conditions

    • Model protein-protein and protein-DNA interactions involving uspB

    • Predict structural changes in uspB in response to various stressors

    • Use homology modeling to compare uspB function across Yersinia species

  • Machine learning applications:

    • Develop predictive models for uspB expression based on environmental parameters

    • Use natural language processing to mine the literature for uspB-related findings

    • Apply pattern recognition to identify uspB binding motifs in the genome

    • Integrate multi-omics data using deep learning approaches

  • Host-pathogen interaction modeling:

    • Create agent-based models of Y. pseudotuberculosis infections incorporating uspB function

    • Model immune response dynamics to infections with wild-type versus uspB mutant strains

    • Predict vaccine efficacy based on immunological parameters and uspB expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.