Recombinant Yersinia pseudotuberculosis serotype IB UPF0059 membrane protein YPTS_1753 (YPTS_1753)

Shipped with Ice Packs
In Stock

Description

Overview of YPTS_1753

YPTS_1753 is a hypothetical membrane protein encoded by the mntP gene in Yersinia pseudotuberculosis serotype IB (strain PB1/+). It is annotated as a putative manganese efflux pump (MntP) involved in maintaining metal ion homeostasis . The recombinant form is produced in Escherichia coli with an N-terminal His tag for purification .

Key features:

  • UniProt ID: B2K0F1

  • Amino acid sequence: 1–189 residues

  • Molecular weight: ~21.8 kDa (predicted)

  • Host system: E. coli

Expression Systems

YPTS_1753 is recombinantly expressed in E. coli using plasmid vectors under T7 promoter control. Key optimizations include:

  • Transcriptional tuning: Adjusting T7 RNA polymerase activity with L-rhamnose to enhance membrane protein yield .

  • Codon harmonization: Gene sequence adjustments to match E. coli codon usage, improving production efficiency .

Purification:

  • Affinity chromatography using His tags .

  • Purity ≥85% as confirmed by SDS-PAGE .

Vaccine Development

Although YPTS_1753 itself has not been directly tested as a vaccine antigen, related Yersinia recombinant proteins (e.g., YopE-LcrV fusion) have shown success in inducing protective immunity against plague . YPTS_1753’s membrane localization makes it a potential candidate for subunit vaccines targeting Y. pseudotuberculosis infections .

Pathogenesis Studies

  • Metal homeostasis: Disruption of mntP could impair bacterial survival under host-induced metal stress .

  • Immune evasion: Membrane proteins like YPTS_1753 may interact with host phagocytes, aiding bacterial persistence .

Comparative Analysis of Production Methods

ParameterWild-Type Codon UsageCodon-OptimizedCodon-Harmonized
Expression LevelLowModerateHigh
Tuning RequirementHighModerateLow
Yield Improvement2–10×3–15×5–20×
Data derived from transcriptional and codon usage optimizations in E. coli .

Challenges and Future Directions

  • Solubility issues: Membrane proteins like YPTS_1753 often require detergents or lipid mimics for stabilization .

  • Functional validation: Further studies are needed to confirm its role in manganese transport and virulence .

  • Immunogenicity testing: Evaluation of YPTS_1753 as a vaccine antigen in animal models is warranted .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
mntP; YPTS_1753; Putative manganese efflux pump MntP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
mntP
Target Protein Sequence
MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA
Uniprot No.

Target Background

Function
This protein is likely involved in manganese efflux as a pump.
Database Links
Protein Families
MntP (TC 9.B.29) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of YPTS_1753 compare to homologous proteins in other Yersinia species?

The YPTS_1753 protein shares significant structural and sequence homology with other UPF0059 membrane proteins across Yersinia species. For instance, the YpsIP31758_2372 protein (UniProt ID: A7FJB3) from Yersinia pseudotuberculosis serotype O:1b exhibits nearly identical amino acid sequence . Both proteins contain similar transmembrane domains and conserved regions typical of the UPF0059 family.

Comparative sequence analysis reveals:

ProteinOrganismUniProt IDLengthSequence Identity
YPTS_1753Y. pseudotuberculosis serotype IBB2K0F1189 aa100% (reference)
YpsIP31758_2372Y. pseudotuberculosis serotype O:1bA7FJB3189 aa~99%

This high degree of conservation suggests functional importance across Yersinia species, potentially related to fundamental cellular processes or pathogenicity mechanisms.

What are the recommended storage conditions for recombinant YPTS_1753 protein?

For optimal stability and activity of recombinant YPTS_1753 protein, the following storage conditions are recommended:

  • Store stock solutions at -20°C, or at -80°C for extended storage periods .

  • Avoid repeated freeze-thaw cycles as they can promote protein degradation and loss of activity .

  • Store working aliquots at 4°C for up to one week to minimize freeze-thaw damage .

  • For long-term storage, add glycerol (typically 50% final concentration) before aliquoting and freezing .

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL before storage .

These conditions are consistent with standard practices for maintaining stability of recombinant membrane proteins, which are often particularly susceptible to denaturation during storage and handling.

What experimental design approaches are most effective for optimizing expression of YPTS_1753 in E. coli systems?

Optimizing expression of membrane proteins like YPTS_1753 in E. coli systems requires a systematic experimental design approach. Based on similar studies with bacterial membrane proteins, a factorial design methodology can identify optimal conditions for soluble, functional protein expression .

Key parameters to evaluate in a factorial design include:

  • Induction conditions:

    • IPTG concentration (typical range: 0.1-1.0 mM)

    • Induction OD600 (recommended starting point: 0.8)

    • Induction duration (4-16 hours)

    • Temperature during induction (18-30°C, with lower temperatures often favoring proper folding)

  • Media composition:

    • Base media (LB, TB, or specialized media)

    • Supplementation with cofactors relevant to the protein

    • Carbon source concentration

    • Antibiotic selection pressure

  • Strain selection:

    • E. coli strains designed for membrane protein expression (C41, C43)

    • Strains with reduced protease activity

    • Rare codon optimization considerations

A typical experimental matrix for optimization would include:

ParameterLevel 1Level 2Level 3Level 4
IPTG concentration0.1 mM0.5 mM1.0 mM-
Induction temperature18°C25°C30°C37°C
MediaLBTBM9-
Induction OD6000.60.81.0-
Induction time4h8h16hOvernight

Analysis of results should focus on both yield and functional activity, as conditions that maximize expression may not optimize proper folding of membrane proteins. For YPTS_1753, conditions similar to those used for other membrane proteins might serve as a starting point: induction at OD600 of 0.8 with 0.1 mM IPTG for 4 hours at 25°C .

How can structural characterization of YPTS_1753 be approached given its membrane-associated nature?

Structural characterization of membrane proteins like YPTS_1753 presents unique challenges compared to soluble proteins. A multi-method approach is recommended:

  • Detergent screening:

    • Test a panel of detergents (DDM, LDAO, OG, etc.) for protein extraction and stability

    • Evaluate using size-exclusion chromatography to confirm monodispersity

  • Crystallization approaches:

    • In-meso crystallization methods (cubic phase, sponge phase)

    • Co-crystallization with antibody fragments or nanobodies

    • Lipidic cubic phase crystallization

  • Alternative structural methods:

    • Cryo-electron microscopy for detergent-solubilized protein

    • NMR studies of isotopically labeled protein in detergent micelles

    • Small-angle X-ray scattering for low-resolution envelope determination

  • Computational approaches:

    • Homology modeling based on structurally characterized UPF0059 family members

    • Molecular dynamics simulations in membrane environments

For initial characterization, circular dichroism spectroscopy can provide valuable information on secondary structure content, particularly the alpha-helical content expected in a transmembrane protein like YPTS_1753.

What methodological approaches can be used to investigate YPTS_1753 function in Yersinia pseudotuberculosis?

Investigating the function of YPTS_1753 requires complementary in vivo and in vitro approaches:

  • Gene deletion and complementation:

    • CRISPR-Cas9-mediated gene knockout

    • Complementation with wild-type or mutated versions

    • Phenotypic characterization of knockout strains

  • Protein interaction studies:

    • Bacterial two-hybrid assays

    • Co-immunoprecipitation with potential interacting partners

    • Cross-linking mass spectrometry to identify proximal proteins in the membrane

  • Subcellular localization:

    • Fluorescent protein fusions with YPTS_1753

    • Immunogold electron microscopy

    • Membrane fractionation studies

  • Transport assays (if suspected to be a transporter):

    • Reconstitution in proteoliposomes

    • Substrate screening using fluorescent reporter systems

    • Electrophysiological measurements in planar lipid bilayers

  • Virulence studies:

    • Infection models comparing wild-type and ΔYPTS_1753 strains

    • Transcriptomic analysis to identify downstream effects

    • Competition assays between wild-type and mutant strains

Given the ongoing research on recombinant Yersinia pseudotuberculosis as vaccine vectors , understanding the role of membrane proteins like YPTS_1753 could contribute to vaccine development strategies.

How should researchers design quantitative experiments to characterize YPTS_1753 expression levels?

Designing robust quantitative experiments to characterize YPTS_1753 expression requires careful consideration of methodology and controls:

  • Expression system selection:

    • Evaluate inducible versus constitutive expression systems

    • Compare expression levels in different E. coli strains

    • Consider codon optimization for enhanced expression

  • Quantification methods:

    • Western blotting with antibodies against the protein or fusion tag

    • qPCR for transcript-level analysis

    • Mass spectrometry-based absolute quantification

    • Fluorescence-based quantification if using fluorescent protein fusions

  • Experimental design principles:

    • Include biological replicates (n ≥ 3) for statistical validity

    • Standardize sample collection and processing

    • Normalize to appropriate housekeeping controls

    • Include positive and negative controls in each experiment

  • Data analysis approaches:

    • Apply appropriate statistical tests (ANOVA, t-tests)

    • Report effect sizes and confidence intervals

    • Consider power analysis to determine sample size requirements

For membrane proteins like YPTS_1753, it's essential to distinguish between total expression and correctly localized, functional protein. Membrane fractionation followed by quantification from each fraction can provide valuable insights into protein trafficking and localization efficiency.

What considerations should be made when designing a recombinant vector system for YPTS_1753 expression?

When designing recombinant vector systems for YPTS_1753 expression, researchers should consider:

  • Promoter selection:

    • For E. coli expression: T7, tac, or arabinose-inducible promoters

    • For expression in Yersinia: native or heterologous promoters with appropriate strength

    • Inducible systems for controlled expression

  • Fusion tag strategies:

    • N-terminal vs. C-terminal tag placement (considering topology prediction)

    • Tag impact on folding and function

    • Cleavable vs. permanent tags

    • Common options: His-tag, FLAG, MBP (for solubility enhancement)

  • Codon optimization:

    • Analysis of rare codons in the YPTS_1753 sequence

    • Optimization for expression host without altering critical folding elements

  • Secretion considerations:

    • Evaluation of native signal sequence functionality in expression host

    • Addition of heterologous signal sequences if needed

    • Type III secretion system (T3SS) compatibility for potential vaccine applications

  • Vector backbone features:

    • Appropriate antibiotic resistance markers

    • Origin of replication compatible with expression host

    • Consideration of copy number effects on expression

A systematic comparison of different expression constructs is recommended, particularly evaluating the impact of various fusion strategies on protein yield, localization, and functionality.

How can researchers effectively analyze potential functional interactions between YPTS_1753 and host immune systems?

To investigate potential interactions between YPTS_1753 and host immune systems, researchers should employ a structured experimental approach:

  • In silico analysis:

    • Epitope prediction using immunoinformatics tools

    • Structural modeling to identify surface-exposed regions

    • Comparison with known immunomodulatory bacterial proteins

  • In vitro immune cell assays:

    • Stimulation of dendritic cells, macrophages with purified YPTS_1753

    • Cytokine profiling using ELISA or multiplex assays

    • Evaluation of pattern recognition receptor activation

    • T-cell activation assays with antigen-presenting cells loaded with YPTS_1753

  • Animal model studies:

    • Comparison of immune responses to wild-type and ΔYPTS_1753 Yersinia strains

    • Tracking cellular and humoral responses following exposure

    • Challenge studies to assess protection conferred by anti-YPTS_1753 responses

  • Translational considerations:

    • Evaluation of cross-reactivity with human immune components

    • Assessment of conservation across Yersinia strains for vaccine potential

    • Analysis of pre-existing immunity in populations exposed to Yersinia species

Drawing from approaches used with other Yersinia proteins, researchers might consider engineering YPTS_1753 as part of fusion constructs for enhanced immunogenicity, similar to the YopE-LcrV fusion approach used in vaccine development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.