Recombinant Yersinia pseudotuberculosis serotype IB UPF0208 membrane protein YPTS_2690 (YPTS_2690)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
YPTS_2690; UPF0208 membrane protein YPTS_2690
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
YPTS_2690
Target Protein Sequence
MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLSEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0208 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Yersinia pseudotuberculosis serotype IB UPF0208 membrane protein YPTS_2690?

YPTS_2690 is a membrane protein from Yersinia pseudotuberculosis serotype IB, classified as part of the UPF0208 protein family. The recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and detection in laboratory settings. This protein consists of 151 amino acids in its full-length form and is predominantly expressed as a membrane-associated protein in its native context . The UPF0208 designation indicates that while the protein has been identified and sequenced, its precise function remains to be fully characterized—making it an interesting target for fundamental research into bacterial membrane biology.

For experimental purposes, this protein is often expressed as a recombinant protein in heterologous systems such as E. coli, allowing researchers to obtain sufficient quantities for biochemical and structural analysis . As a membrane protein, YPTS_2690 likely contains hydrophobic regions that integrate into the lipid bilayer, with hydrophilic portions extending into either the cytoplasm or periplasm.

How does YPTS_2690 compare to similar membrane proteins across bacterial species?

Membrane proteins like YPTS_2690 contribute to the approximately 25% of the proteome devoted to integral membrane proteins across all organisms . While YPTS_2690 is specific to Y. pseudotuberculosis, comparative analysis with homologous proteins from other bacterial species can provide insights into conserved functional domains. When performing such comparative analyses, researchers should:

  • Conduct sequence alignment with homologous proteins from related Yersinia species (Y. pestis, Y. enterocolitica)

  • Identify conserved motifs that might indicate functional domains

  • Compare predicted transmembrane topologies to determine structural conservation

This comparison is particularly valuable given that Yersinia pseudotuberculosis exhibits more genetic diversity than its descendant species Y. pestis, which has undergone reductive evolution . The specific role of YPTS_2690 in membrane biology may represent either a conserved function across enterobacteria or a specialized adaptation in Y. pseudotuberculosis.

What expression systems are recommended for recombinant YPTS_2690 production?

Expression SystemAdvantagesLimitationsRecommended for YPTS_2690?
E. coliHigh yield, rapid growth, economicalPotential folding issues with membrane proteins, lacks eukaryotic PTMsYes - for basic structural studies
YeastBetter folding of complex proteins, some PTMsLower yield than E. coli, longer growth timePossibly - for functional studies
Insect cellsGood for complex membrane proteinsMore expensive, technically demandingPotentially - for structural biology applications
Mammalian cellsNative-like folding and PTMsHighest cost, lowest yieldNot typically necessary

When expressing YPTS_2690, researchers should be aware of common challenges with membrane protein expression, including protein toxicity, hydrophobicity issues, and proper membrane insertion . Optimization strategies might include:

  • Using specialized E. coli strains designed for membrane protein expression

  • Adjusting induction conditions (temperature, inducer concentration)

  • Testing different detergents for efficient extraction from membranes

  • Considering fusion partners that enhance solubility and membrane targeting

What biogenesis pathways are likely involved in YPTS_2690 membrane insertion?

As an integral membrane protein, YPTS_2690 must be properly inserted into the bacterial membrane to function correctly. Current models of membrane protein biogenesis suggest that proteins like YPTS_2690 likely utilize specific insertion pathways depending on their topological characteristics .

Based on current understanding of membrane protein insertion mechanisms, YPTS_2690 would follow one of two primary pathways:

  • Oxa1 pathway: If YPTS_2690 contains transmembrane domains flanked by short translocated segments, it likely utilizes the Oxa1 family proteins for insertion. This pathway typically handles simpler membrane protein topologies .

  • SecY pathway: If YPTS_2690 contains transmembrane domains flanked by longer translocated segments, the SecY channel would be required for proper insertion. This pathway accommodates more complex topological arrangements .

To experimentally determine which pathway is involved, researchers could:

  • Perform depletion studies of key components in each pathway

  • Use fluorescent tagging to track the localization of YPTS_2690 during biogenesis

  • Conduct in vitro reconstitution experiments with purified components of each pathway

Understanding the insertion mechanism has significant implications for protein function, as improper membrane integration can lead to misfolding, aggregation, or altered functionality.

What structural characterization techniques are most effective for YPTS_2690?

As a membrane protein, YPTS_2690 presents unique challenges for structural characterization. Researchers should consider the following techniques based on their specific research questions:

TechniqueInformation ProvidedPractical Considerations
X-ray crystallographyHigh-resolution atomic structureChallenging for membrane proteins; requires stabilization in detergent micelles or lipidic cubic phase
Cryo-electron microscopyMedium to high-resolution structureIncreasingly viable for smaller membrane proteins; may require incorporation into nanodiscs
NMR spectroscopyDynamic information and solution structureSize limitations; suitable for individual domains or in detergent micelles
Circular dichroismSecondary structure contentLow resolution but accessible; good for initial characterization
Hydrogen-deuterium exchange MSSolvent accessibility and conformational dynamicsProvides complementary information to high-resolution techniques

For initial characterization of YPTS_2690, researchers should:

  • Begin with bioinformatic prediction of transmembrane domains and secondary structure

  • Confirm predicted secondary structure with circular dichroism

  • Optimize conditions for stability in detergent micelles

  • Progress to higher-resolution techniques as feasible

The three-dimensional structure analysis of full-length proteins like YPTS_2690 provides essential information about their function and interaction mechanisms . For membrane proteins, maintaining native-like environments during structural studies is crucial for obtaining physiologically relevant information.

How might YPTS_2690 contribute to Y. pseudotuberculosis pathogenicity?

Y. pseudotuberculosis is known to cause a range of clinical manifestations, including Far East scarlet-like fever (FESLF) with symptoms such as erythematous skin rash, desquamation, and toxic shock syndrome . While the specific role of YPTS_2690 in pathogenicity has not been explicitly described in the provided search results, we can hypothesize potential functions based on general knowledge of bacterial membrane proteins:

  • Membrane integrity maintenance: YPTS_2690 might contribute to bacterial survival under host conditions by maintaining membrane stability

  • Transport function: It could facilitate transport of essential nutrients or export of virulence factors

  • Sensing and signaling: As a membrane protein, it might participate in sensing environmental conditions within the host

  • Immune evasion: Some membrane proteins help pathogens evade host immune responses

To investigate potential pathogenicity roles, researchers could:

  • Generate knockout mutants and assess virulence in appropriate models

  • Evaluate expression levels under host-mimicking conditions

  • Identify interaction partners through co-immunoprecipitation studies

  • Perform comparative analysis with clinical isolates expressing variant forms

Y. pseudotuberculosis contains several unique virulence determinants that trigger and modulate host immune responses . Further characterization of YPTS_2690 could reveal whether it contributes to the distinctive clinical presentations associated with Y. pseudotuberculosis infections.

What are the optimal conditions for recombinant YPTS_2690 expression and purification?

Successful expression and purification of membrane proteins like YPTS_2690 require careful optimization. Based on general principles for membrane protein work and specific information about YPTS_2690 , researchers should consider:

Expression optimization:

  • Use E. coli strains specifically designed for membrane protein expression (C41, C43, or Lemo21)

  • Test various induction conditions (0.1-1.0 mM IPTG, 16-30°C induction temperature)

  • Consider co-expression with chaperones to enhance proper folding

  • Optimize growth media (e.g., Terrific Broth with glycerol supplementation)

Purification strategy:

  • Solubilize membranes using detergents appropriate for downstream applications (DDM, LMNG, or Fos-choline series)

  • Utilize the N-terminal His-tag for initial IMAC purification

  • Consider increasing imidazole concentration during elution to distinguish full-length protein from truncated products

  • Perform size exclusion chromatography as a polishing step

Quality control checks:

  • SDS-PAGE to verify size and purity

  • Western blotting with anti-His antibodies

  • Mass spectrometry to confirm intact protein

  • Functional assays (if known) to verify activity

Researchers should be aware that membrane protein expression yields are typically lower than soluble proteins, often requiring optimization of culture volume and extraction conditions to obtain sufficient material for downstream applications.

How can researchers effectively study protein-protein interactions involving YPTS_2690?

Investigating protein-protein interactions for membrane proteins presents unique challenges. For YPTS_2690, researchers should consider these approaches:

  • Co-immunoprecipitation (Co-IP): This technique has been successfully used to study protein-protein interactions in Yersinia species . For YPTS_2690, the His-tag can be leveraged for pull-down experiments, followed by mass spectrometry to identify interaction partners.

  • Bacterial two-hybrid systems: Modified specifically for membrane proteins, these systems can identify potential interaction partners in vivo.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking can capture transient interactions, which is particularly useful for membrane proteins that may have dynamic interaction networks.

  • FRET/BRET approaches: For studying interactions in living bacteria, fluorescence or bioluminescence resonance energy transfer can provide spatial and temporal information about YPTS_2690 interactions.

  • Surface plasmon resonance: For in vitro confirmation of specific interactions, SPR can provide binding kinetics when one partner is immobilized and the other is in solution.

When conducting protein-protein interaction studies with YPTS_2690, maintaining the protein in a native-like membrane environment is crucial. Consider using nanodiscs, proteoliposomes, or suitable detergent micelles to preserve the structural integrity of the protein during interaction studies.

What approaches can address challenges in YPTS_2690 membrane protein crystallization?

Crystallization of membrane proteins like YPTS_2690 remains challenging but several approaches have improved success rates:

  • Lipidic cubic phase (LCP) crystallization: This method provides a membrane-mimetic environment that can facilitate crystal formation of membrane proteins. For YPTS_2690, screening different lipid compositions within the LCP matrix may identify favorable crystallization conditions.

  • Antibody fragment co-crystallization: Fusing YPTS_2690 with antibody fragments (Fab, nanobody) can provide additional hydrophilic surfaces for crystal contacts while stabilizing specific conformations.

  • Fusion protein approaches: Inserting a soluble, crystallizable protein (e.g., T4 lysozyme) into a loop of YPTS_2690 or at termini can enhance crystallizability by providing additional crystal contacts.

  • Detergent screening: Systematic testing of different detergents and detergent mixtures can identify conditions that maintain protein stability while promoting crystal formation.

  • Construct optimization: Creating truncations or targeted mutations that remove flexible regions while maintaining core structure can improve crystallization propensity.

Researchers should implement a systematic approach to crystallization screening, testing multiple variables:

  • Temperature (4°C and 20°C)

  • Precipitant concentration and type

  • pH range (typically 4.0-9.0)

  • Additives (especially membrane protein-specific additives)

  • Lipid:protein ratios (for LCP approaches)

How might YPTS_2690 be utilized in bacterial membrane biogenesis studies?

YPTS_2690 represents an opportunity to investigate fundamental aspects of bacterial membrane biogenesis. Researchers can leverage this protein to:

  • Test current models of membrane protein insertion: The unified model proposing differential roles for Oxa1 and SecY pathways can be tested using YPTS_2690 as a substrate protein.

  • Investigate co-translational insertion mechanisms: By studying ribosome-nascent chain complexes of YPTS_2690, researchers can explore how proximity to the membrane facilitates insertion of multi-transmembrane domain proteins .

  • Examine membrane protein quality control: YPTS_2690 can serve as a model substrate to investigate how bacterial cells handle misfolded membrane proteins.

  • Study lateral membrane organization: Tagged versions of YPTS_2690 could be used to examine membrane domain organization in bacterial cells.

Experimental approaches might include:

  • Pulse-chase experiments to track biogenesis kinetics

  • Site-specific crosslinking to identify transient interactions during biogenesis

  • Reconstitution of the insertion pathway with purified components

  • Super-resolution microscopy to visualize membrane organization

These studies would contribute to our understanding of the fundamental principles governing membrane protein biogenesis, which remains an active area of research with implications for bacterial physiology and antibiotic development.

What role might YPTS_2690 play in comparative genomics studies of Yersinia species?

Comparative genomics studies involving YPTS_2690 could provide insights into the evolution and speciation of Yersinia species. Key approaches include:

  • Phylogenetic analysis: Comparing YPTS_2690 sequences across Yersinia strains and related enterobacteria to reconstruct evolutionary relationships.

  • Structural conservation assessment: Examining whether structural features of YPTS_2690 are conserved despite sequence variation.

  • Contextual genomic analysis: Investigating the genomic context of YPTS_2690 to identify conserved operons or evidence of horizontal gene transfer.

  • Expression pattern comparison: Determining whether YPTS_2690 expression patterns differ between Y. pseudotuberculosis strains that cause different clinical manifestations.

How might advanced structural biology techniques advance our understanding of YPTS_2690?

Emerging structural biology approaches offer new opportunities for characterizing membrane proteins like YPTS_2690:

  • Integrative structural biology: Combining multiple techniques (cryo-EM, NMR, SAXS, computational modeling) to overcome limitations of individual methods.

  • Time-resolved structural studies: Capturing dynamic structural changes during function using techniques like time-resolved cryo-EM or X-ray free electron lasers.

  • In-cell structural biology: Determining the structure of YPTS_2690 within its native cellular environment using techniques like in-cell NMR or correlative light and electron microscopy.

  • AlphaFold2 and related AI approaches: Leveraging AI-based structure prediction tools to generate initial models that can guide experimental design and interpretation.

These approaches could reveal not just the static structure of YPTS_2690 but also its dynamic behavior during membrane insertion, interaction with other proteins, and functional cycles. This information would significantly advance our understanding of this protein's role in bacterial physiology.

What potential does YPTS_2690 hold as a therapeutic target against Y. pseudotuberculosis infections?

While primarily a research tool, YPTS_2690 could potentially serve as a therapeutic target if further research establishes its importance in bacterial virulence or survival:

  • Target validation: Researchers would need to establish whether YPTS_2690 is essential for bacterial viability or virulence through knockout studies and infection models.

  • Druggability assessment: Computational and experimental approaches could evaluate whether YPTS_2690 contains binding pockets amenable to small molecule inhibition.

  • Fragment-based screening: If druggable pockets are identified, fragment libraries could be screened against purified YPTS_2690 to identify starting points for inhibitor development.

  • Antibody-based approaches: If YPTS_2690 has extracellular domains, antibodies targeting these regions could potentially neutralize bacterial function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.