Recombinant Yersinia pseudotuberculosis serotype IB UPF0283 membrane protein YPTS_2342 (YPTS_2342)

Shipped with Ice Packs
In Stock

Description

Introduction

Yersinia pseudotuberculosis is a Gram-negative bacterium that causes a range of human illnesses, primarily gastroenteritis and Far East scarlet-like fever (FESLF) . The Yersinia genus also includes Yersinia pestis, the causative agent of plague, which evolved from Y. pseudotuberculosis relatively recently . Studying the proteins of Y. pseudotuberculosis is crucial for understanding its pathogenesis and for identifying potential targets for antimicrobial development . One such protein is the Recombinant Yersinia pseudotuberculosis serotype IB UPF0283 membrane protein YPTS_2342 (YPTS_2342).

General Information

YPTS_2342 is a protein of unknown function (UPF0283) located in the membrane of Y. pseudotuberculosis serotype IB . The precise function of YPTS_2342 is not yet known, but bioinformatics analyses and experimental studies may offer insights into its potential roles.

Structure and Function Prediction

Because YPTS_2342 is a membrane protein, it is likely to have hydrophobic regions that allow it to embed within the lipid bilayer . Further research, such as X-ray crystallography or NMR spectroscopy, would be needed to determine the detailed three-dimensional structure of the protein.

Role in Pathogenicity

Y. pseudotuberculosis employs several mechanisms to cause disease, including adhesion to host cells, invasion, and production of toxins . The complete genome sequence of Y. pseudotuberculosis IP31758 has revealed the presence of a unique type I R/M system, which is not present in all studied Y. pestis strains . The YAPI-encoded surface exposed elements such as pilin might be associated with the severe host immune response observed in patients with FESLF . Given its location in the membrane, YPTS_2342 may be involved in interactions with the host environment or in the transport of molecules across the bacterial membrane . Further studies, such as gene knockout experiments or protein interaction assays, would be required to determine whether YPTS_2342 contributes to the virulence of Y. pseudotuberculosis .

Essentiality

Essential genes are the core genetic elements required for basic survival processes in a given growth condition and are attractive targets for antimicrobials . A study utilizing transposon-directed insertion site sequencing (TraDIS) was conducted to describe the essential gene set of Y. pseudotuberculosis IP32953 in optimized in vitro growth conditions and to contrast these with the published essential genes of Y. pestis . Comparing the essential genes of Y. pseudotuberculosis with those of Y. pestis revealed the genes whose importance are shared by both species, as well as genes that were differentially required for growth .

Tables

Tables are used to organize data that is too detailed or complicated to be described adequately in the text, allowing the reader to quickly see the results . The title should clearly describe what the table is about, and the column heads should be descriptive and clearly indicate the nature of the data presented .

Protein NameOrganismLocationFunction
YPTS_2342Y. pseudotuberculosis IBMembraneUnknown (UPF0283)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
YPTS_2342; UPF0283 membrane protein YPTS_2342
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Target Names
YPTS_2342
Target Protein Sequence
MSEPLKPRIDFEQPLQSLDEPVLKSAQAFDEQAAEKFYPAAPELDAEDEEGRVEGLVNAA LKPKRSLWRKMVTAGMVILGASVIAQSVQWVNQAWQQQDWIALGATTAGGLIILAGVGSV VTEWRRLYHLRQRAEERDIARALLVSHGVGQGRVFCEKLARQAGLDQGHPALQRWLASLH ETHNDREVVELYAKLVQPALDNQARAEISRYAAESALMIAVSPLALVDMAFIAWRNIRLI NRIAALYGIELGYFSRIRLFRLVLLNIAFAGASELVREVGMDWLSQDLAARLSARAAQGI GAGLLTARLGIKAMELCRPLPWLEGDKPKLGDFRRQLMNQLKNTLPKKDKTAH
Uniprot No.

Target Background

Database Links
Protein Families
UPF0283 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Recombinant Yersinia pseudotuberculosis serotype IB UPF0283 membrane protein YPTS_2342?

Recombinant Yersinia pseudotuberculosis serotype IB UPF0283 membrane protein YPTS_2342 is a full-length membrane protein expressed in Yersinia pseudotuberculosis serotype IB strain PB1/+. This protein belongs to the UPF0283 family and is encoded by the YPTS_2342 gene. The full amino acid sequence consists of 353 amino acid residues with specific structural features that enable its membrane-associated functions .

The protein contains multiple transmembrane domains with predicted alpha-helical structures that anchor it to the bacterial cell membrane. Analysis of its sequence reveals characteristics typical of bacterial membrane proteins, including hydrophobic segments that span the membrane and hydrophilic regions that likely interact with the cytoplasm or extracellular environment .

What is the role of Yersinia pseudotuberculosis membrane proteins in pathogenesis?

Yersinia pseudotuberculosis (Yptb) is a gram-negative bacterium that causes intestinal infection with potential to spread to the liver, where it induces hemosiderosis, abscesses, and hepatitis. Membrane proteins play crucial roles in its pathogenic mechanisms through multiple functions :

  • Evasion of host immune response through Type III secretion system proteins that suppress phagocytic activity

  • Membrane-associated toxins involved in anti-phagocytic defense

  • Contribution to bacterial colonization of lymphoid organs through effects on host immune cells

  • Modulation of phagocyte activity and polarization, particularly promoting bacterial survival in macrophages

  • Regulation of bacterial-induced macrophage polarization toward the M2 phenotype

Specifically, Yptb expresses both plasmid-encoded and chromosome-encoded proteins that interact with host cells to promote infection and disease progression. The membrane proteins facilitate bacterial dissemination and colonization of organs, particularly the liver .

How is the full-length recombinant YPTS_2342 protein typically stored and handled?

The recombinant YPTS_2342 protein requires specific storage and handling conditions to maintain its structural integrity and biological activity:

Storage ParameterRecommended ConditionNotes
Storage bufferTris-based buffer with 50% glycerolOptimized for this specific protein
Short-term storage4°CFor working aliquots up to one week
Medium-term storage-20°CStandard storage condition
Long-term storage-80°CFor extended preservation
Freeze-thaw cyclesMinimizeRepeated freezing and thawing not recommended

When handling this recombinant protein, researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity. It is advisable to prepare small working aliquots for routine experiments while maintaining the stock at -80°C for long-term stability .

What are the optimal conditions for expressing recombinant Yersinia membrane proteins?

Expression of recombinant Yersinia membrane proteins, including YPTS_2342, requires careful optimization of expression systems and conditions. Based on research findings, the following considerations are critical:

  • Host Selection: While E. coli is commonly used for recombinant protein expression, membrane proteins often benefit from expression in specialized strains designed for membrane protein production or in Yersinia-derived expression systems.

  • Growth Conditions: Contrary to conventional approaches, the highest protein yields aren't always achieved under the most rapid growth conditions. Research indicates that controlled growth conditions with careful monitoring of growth phase is critical .

  • Harvest Timing: It is crucial to harvest cells prior to glucose exhaustion, just before the diauxic shift. The growth phase at which cells are harvested significantly impacts membrane protein yields .

  • Temperature Regulation: Lower induction temperatures (16-25°C) often improve the folding and membrane integration of recombinant membrane proteins.

  • Induction Strategy: Gentle induction using lower concentrations of inducers over longer periods typically results in better expression of functional membrane proteins .

The differences in membrane protein yields under various culture conditions are not necessarily reflected in corresponding changes in mRNA levels, but rather relate to differential expression of genes involved in membrane protein secretion and cellular physiology .

What purification approaches are most effective for YPTS_2342 membrane protein?

Purification of YPTS_2342 membrane protein requires specialized approaches due to its hydrophobic nature and membrane localization. A systematic purification strategy typically includes:

  • Membrane Isolation: Cell disruption followed by differential centrifugation to isolate membrane fractions containing the target protein.

  • Solubilization: Careful selection of detergents is critical. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) often preserve protein structure and function better than harsh detergents like SDS.

  • Affinity Chromatography: Tag-based purification using the protein's fusion tag. For YPTS_2342, the tag type is determined during the production process and optimized for the specific protein characteristics .

  • Size Exclusion Chromatography: Further purification based on molecular size to remove aggregates and contaminants.

  • Quality Assessment: Verification of protein purity and integrity through SDS-PAGE, Western blotting, and mass spectrometry.

For functional studies, researchers may employ the droplet-on-hydrogel bilayer technique, which allows high-resolution functional studies of membrane proteins with independent control of electrical and chemical transmembrane potential .

How can researchers assess the functional activity of recombinant YPTS_2342?

Assessment of YPTS_2342 functional activity requires specialized techniques adapted for membrane proteins:

  • Droplet-on-Hydrogel Bilayer Assay: This advanced technique allows high-resolution functional studies of membrane proteins with independent control of electrical and chemical transmembrane potential .

  • Transmembrane Transport Assays: Measuring substrate transport across membranes using reconstitution in liposomes or proteoliposomes.

  • Patch-Clamp Electrophysiology: For potential ion channel or transporter functions.

  • Protein-Protein Interaction Studies: Co-immunoprecipitation or crosslinking studies to identify interaction partners, which may provide clues about function.

  • Mutational Analysis: Systematic mutation of key residues to identify functional domains and critical amino acids.

When conducting these assays, it is essential to maintain the protein in a native-like membrane environment, as detergent micelles may not fully recapitulate the natural lipid bilayer context required for proper function .

How can researchers address contradictions in experimental data related to YPTS_2342 function?

When faced with contradictions in experimental data relating to YPTS_2342 function, researchers should implement a systematic approach to resolve these discrepancies:

  • Contextualize the Contradictions: First, determine if the contradictions are genuine or merely apparent due to different experimental contexts. In biomedical literature, apparent contradictions often arise from differences in experimental conditions rather than true biological contradictions .

  • Categorize the Contextual Characteristics: Classify contradictions into categories such as:

    • Internal to the experimental system (e.g., cell type, protein concentration)

    • External factors (e.g., experimental conditions, reagent quality)

    • Endogenous/exogenous factors

    • Known controversies in the field

    • Contradictions in literature interpretation

  • Formalize Contradiction Patterns: Consider using formal notation for contradiction patterns, such as the (α, β, θ) model where:

    • α represents the number of interdependent items

    • β represents the number of contradictory dependencies

    • θ represents the minimal number of required Boolean rules to assess these contradictions

  • Design Discriminating Experiments: Develop experiments specifically designed to test competing hypotheses and resolve contradictions.

  • Collaborative Validation: Engage with other research groups to independently validate findings under standardized conditions.

Remember that contradictions often mark the first step in progress toward knowledge advancement. As noted by Alfred North Whitehead: "In formal logic, a contradiction is the signal of defeat, but in the evolution of real knowledge, it marks the first step in progress toward a victory" .

How does the YPTS_2342 protein contribute to Yersinia pseudotuberculosis pathogenicity compared to other virulence factors?

  • Type III Secretion System (T3SS): Yersinia pseudotuberculosis expresses at least six plasmid-encoded Yersinia outer proteins belonging to the T3SS, which suppress phagocytic activity. These proteins are well-characterized virulence factors .

  • Chromosome-Encoded Toxins: Evidence indicates that chromosome-encoded protein toxins are also involved in anti-phagocytic defense. These toxins are frequently found in isolates from patients with Far East scarlet-like fever, often accompanied by liver pathology .

  • Immune Modulation: Yersinia proteins contribute to bacterial colonization of lymphoid organs through their effects on immune cells, particularly by promoting bacterial survival in macrophages and facilitating bacterial-induced macrophage polarization towards the M2 phenotype .

  • YPTS_2342 Potential Role: As a membrane protein, YPTS_2342 may contribute to pathogenicity through:

    • Membrane integrity maintenance

    • Nutrient acquisition or waste export

    • Signaling and sensing environmental conditions

    • Potential interactions with host factors

To definitively determine YPTS_2342's role in pathogenicity, researchers might consider developing a recombinant attenuated strain with YPTS_2342 deletion or modification, similar to the approach used in other studies of Yersinia virulence factors .

What are the most effective approaches for studying membrane protein-host interactions in the context of Yersinia infection?

Investigating membrane protein-host interactions in Yersinia infection requires sophisticated methodological approaches:

  • Recombinant Attenuated Strains: Engineering strains with specific mutations (e.g., Δ yopK Δ yopJ Δ asd) that maintain immunogenicity while reducing pathogenicity allows for safer study of protein-host interactions .

  • T3SS-Mediated Delivery Systems: Using the bacterium's own Type III secretion system to deliver fusion proteins (such as YopE-LcrV) to host cells provides insights into membrane protein translocation and host cell interactions .

  • Structural Biology Approaches: Techniques like cryo-electron microscopy and X-ray crystallography can reveal the molecular details of membrane protein interactions with host factors.

  • Infection Models: Various models can be employed:

    Model TypeAdvantagesLimitations
    Cell cultureControlled environment, specific cell typesLacks tissue complexity
    Ex vivo tissueMaintains tissue architectureShort lifespan
    Mouse modelWhole organism responseSpecies differences
    3D organoidsHuman tissue-like structureLacks systemic response
  • Real-time Imaging: Advanced microscopy techniques allow visualization of membrane protein dynamics during infection.

  • Proteomics and Interactomics: Mass spectrometry-based approaches can identify host proteins that interact with bacterial membrane proteins during different stages of infection.

When studying YPTS_2342 specifically, researchers should consider its potential interactions with host membrane proteins and immune system components, as these interactions could be crucial for pathogenesis .

How can YPTS_2342 be utilized in the development of new antimicrobial strategies?

YPTS_2342, as a membrane protein from Yersinia pseudotuberculosis, presents several opportunities for antimicrobial strategy development:

  • Target for Antimicrobial Development: If YPTS_2342 proves essential for bacterial survival or virulence, it could be targeted by small-molecule inhibitors or antibodies designed to disrupt its function.

  • Vaccine Component: Research has demonstrated that recombinant attenuated Yersinia strains can be engineered to deliver protective antigens. Similarly, YPTS_2342 or its immunogenic epitopes could potentially be incorporated into vaccine candidates if they elicit protective immune responses .

  • Diagnostic Marker: As a membrane protein specific to Yersinia pseudotuberculosis serotype IB, YPTS_2342 could serve as a diagnostic marker for rapid identification of this pathogen in clinical samples.

  • Drug Delivery System: Knowledge of YPTS_2342's structure and function could inform the design of drug delivery systems that target Yersinia-infected cells specifically.

  • Biomimetic Applications: Understanding the structural and functional properties of YPTS_2342 could inspire the design of artificial membrane proteins with novel functions, similar to how other membrane protein motifs have been used in protein engineering .

The development of these strategies requires thorough characterization of YPTS_2342's role in bacterial physiology and pathogenesis, as well as evaluation of its conservation across Yersinia strains and potential for triggering protective immunity.

What technological advancements have improved the study of difficult membrane proteins like YPTS_2342?

Recent technological advancements have significantly enhanced our ability to study challenging membrane proteins like YPTS_2342:

  • Expression System Optimization: Research has revealed that the most rapid growth conditions are not necessarily optimal for membrane protein production. Controlled growth conditions and precise harvest timing (before glucose exhaustion and diauxic shift) significantly improve yields .

  • Droplet-on-Hydrogel Bilayer Technique: This innovative approach allows high-resolution functional studies of membrane proteins with independent control of electrical and chemical transmembrane potential, enabling detailed characterization of membrane protein function .

  • Artificial Membrane Protein Design: Understanding how small-residue packing motifs (involving amino acids like glycine, alanine, and serine) influence membrane protein structure has led to the development of more stable and functional recombinant membrane proteins .

  • Cryo-Electron Microscopy: Advances in cryo-EM have revolutionized structural studies of membrane proteins, allowing visualization at near-atomic resolution without the need for crystallization.

  • Native Mass Spectrometry: This technique enables the analysis of intact membrane protein complexes, providing insights into their composition, stoichiometry, and interactions.

  • Computational Prediction Tools: AI-based tools like AlphaFold2 have dramatically improved the accuracy of membrane protein structure prediction, facilitating functional studies even in the absence of experimental structures.

  • Nanodiscs and Lipid Cubic Phase Technologies: These approaches provide more native-like environments for membrane proteins, improving their stability and functional integrity during purification and characterization.

These technological advancements collectively address the traditional challenges in membrane protein research, making previously intractable proteins like YPTS_2342 more accessible to scientific investigation.

What are the emerging research questions regarding YPTS_2342 and similar membrane proteins?

Several emerging research questions present opportunities for advancing our understanding of YPTS_2342 and related membrane proteins:

  • Structure-Function Relationships: How do specific structural motifs in YPTS_2342 relate to its function in Yersinia pseudotuberculosis? Understanding these relationships could inform rational drug design targeting this protein.

  • Evolutionary Conservation: How conserved is YPTS_2342 across Yersinia species and strains? Are there structural or functional variations that correlate with differences in virulence or host specificity?

  • Host-Pathogen Interactions: Does YPTS_2342 interact directly with host factors during infection? If so, which host molecules are involved, and how do these interactions contribute to pathogenesis?

  • Regulation of Expression: What environmental and host factors regulate the expression of YPTS_2342 during different stages of infection? Understanding this regulation could reveal critical triggers for virulence.

  • Membrane Protein Networks: How does YPTS_2342 interact with other bacterial membrane proteins to form functional complexes? These protein-protein interactions within the bacterial membrane might represent novel targets for antimicrobial development.

  • Artificial Intelligence Applications: Can AI-driven approaches improve our ability to predict the structure and function of YPTS_2342 and guide experimental design? The application of machine learning to membrane protein research represents a frontier with significant potential.

  • Synthetic Biology Approaches: Could engineered variants of YPTS_2342 be used to develop novel cellular tools or therapeutic delivery systems? The principles learned from natural membrane proteins increasingly inform synthetic biology applications.

Addressing these questions will require interdisciplinary approaches combining structural biology, microbiology, immunology, and computational methods.

How might systems biology approaches enhance our understanding of YPTS_2342's role in the bacterial membrane proteome?

Systems biology approaches offer powerful frameworks for contextualizing YPTS_2342 within the broader bacterial membrane proteome and cellular function:

  • Multi-omics Integration: Combining proteomics, transcriptomics, and metabolomics data can reveal how YPTS_2342 expression correlates with other cellular processes and environmental conditions, providing insights into its functional role.

  • Protein-Protein Interaction Networks: Comprehensive mapping of YPTS_2342's interactions with other bacterial proteins can position it within functional networks and suggest its role in cellular processes.

  • Comparative Systems Analysis: Comparing membrane proteome composition and function across Yersinia strains with varying virulence can highlight the contribution of specific membrane proteins like YPTS_2342 to pathogenesis.

  • Host-Pathogen System Modeling: Computational models integrating bacterial and host factors can simulate infection dynamics and predict the impact of targeting specific membrane proteins.

  • Temporal Systems Analysis: Tracking changes in the membrane proteome throughout the infection cycle can reveal when and where YPTS_2342 becomes critical for bacterial survival or virulence.

  • Perturbation Analysis: Systematic disruption of membrane protein expression (through CRISPR interference or similar approaches) can reveal functional dependencies and hierarchies within the membrane proteome.

  • Evolutionary Systems Biology: Analyzing the co-evolution of membrane proteins across bacterial species can provide insights into functional constraints and adaptations related to host interaction.

By placing YPTS_2342 within these broader contexts, systems biology approaches can generate testable hypotheses about its function and significance, guiding more targeted experimental investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.