The Recombinant Yersinia pseudotuberculosis serotype IB UPF0299 membrane protein YPTS_1639 (YPTS_1639) is a bioengineered protein derived from the enteric pathogen Yersinia pseudotuberculosis. It belongs to the UPF0299 family of uncharacterized membrane proteins and serves as a research tool for studying bacterial membrane biology and pathogenesis. This recombinant protein is produced in E. coli with an N-terminal histidine tag (His-tag) for purification and structural stability.
Pathogen-host interactions: Similar to other Yersinia membrane proteins, it may play a role in adhesion, invasion, or immune evasion .
Membrane integrity: Structural stability or signaling, though no direct evidence exists .
No interacting proteins or regulatory pathways have been reported in peer-reviewed studies .
The recombinant protein is manufactured via bacterial expression systems optimized for membrane protein synthesis:
Low solubility: Membrane proteins often require detergents for solubilization, but no such data is provided for YPTS_1639 .
Activity validation: Functional assays (e.g., binding or enzymatic activity) are absent in available literature .
While YPTS_1639 is marketed as a research reagent, its utility in scientific studies is limited by sparse data:
Vaccine Development: Unlike Y. pestis LcrV or F1 antigens used in plague vaccines, YPTS_1639 has no documented role in immunity .
Pathogenesis Studies: No evidence links it to Yersinia virulence factors (e.g., Yops, LPS) or host cell invasion mechanisms .
Structural Biology: Crystallization or cryo-EM studies are not reported, restricting insights into its tertiary structure .
To advance understanding of YPTS_1639, priority areas include:
Functional screening: High-throughput assays to identify interactions with host receptors (e.g., DC-SIGN, CD209) .
Structural analysis: X-ray crystallography or NMR to elucidate its membrane topology and potential ligand-binding sites .
Pathogenicity studies: Knockout mutants in Y. pseudotuberculosis to assess phenotypic changes in infection models.
KEGG: ypb:YPTS_1639
YPTS_1639 is a UPF0299 family membrane protein found in Yersinia pseudotuberculosis serotype IB. The full-length protein consists of 135 amino acids with the sequence: MRNMMSLCWQYLRAFTIIYLCLWAGKALALLLPIVIPGSIIGMLILFVLLTLQILPSPWVKPSCQLLIRYMALLFVPIGVGVMQYYEQLTKQFGPIVVSCFISTLIVMLVVAYSSHYVHRDRKVISPSTPTEGEK . The protein contains several hydrophobic regions consistent with its membrane localization. Analysis of the amino acid composition reveals multiple transmembrane domains, suggesting it spans the bacterial membrane multiple times, which is typical for proteins in the UPF0299 family.
When designing experiments to study this protein, researchers should consider its membrane-associated nature. The protein carries the UniProt ID B2JZJ8, which allows access to additional structural information and predicted functional domains through database queries .
For optimal preservation of recombinant YPTS_1639 protein activity, storage and reconstitution protocols must be carefully followed. The lyophilized protein should be stored at -20°C/-80°C upon receipt . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity .
For reconstitution, first centrifuge the vial briefly to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To prevent degradation during storage, add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation) . This preparation should then be aliquoted for long-term storage at -20°C or -80°C.
The protein is typically supplied in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution . When designing experiments, researchers should consider potential buffer effects on downstream applications.
The most common expression system for recombinant YPTS_1639 is Escherichia coli . When expressing membrane proteins like YPTS_1639, several methodological considerations become crucial:
Vector selection: Plasmid vectors with strong inducible promoters are typically used to control expression timing and level.
Tag selection: His-tagging is commonly employed to facilitate purification, with the tag positioned at the N-terminus to avoid interfering with membrane insertion mechanisms .
Host strain selection: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results than standard laboratory strains.
Growth conditions: Lower temperatures (16-25°C) during induction often improve proper folding of membrane proteins.
Induction parameters: IPTG concentration and induction timing require optimization to balance yield with proper folding.
When designing your expression protocol, it's important to note that the methodologies used for cytoplasmic proteins may not be optimal for membrane proteins. Additionally, consideration should be given to potential toxicity effects when overexpressing membrane proteins in bacterial systems.
When designing experiments to study YPTS_1639 function, researchers should consider both pre-experimental and true experimental research designs. According to experimental research principles, a true experimental approach with proper controls provides the most reliable results .
For YPTS_1639 functional studies, implement a posttest-only control group design or a pretest-posttest control group design to evaluate protein activity . In this approach:
Control groups: Include both negative controls (without YPTS_1639) and positive controls (with known membrane proteins of similar size and properties).
Random assignment: Assign experimental conditions randomly to minimize bias, following true experimental design principles .
Variables: Clearly define dependent variables (e.g., membrane integrity, protein interactions) and independent variables (e.g., YPTS_1639 concentration, environmental conditions).
Replication: Ensure sufficient biological and technical replicates for statistical validity.
The Solomon four-group design provides the most comprehensive approach for YPTS_1639 functional studies . This design incorporates four groups: (1) pretested experimental group, (2) pretested control group, (3) non-pretested experimental group, and (4) non-pretested control group. This methodology allows researchers to account for potential testing effects while studying YPTS_1639 function in membrane systems.
To effectively study YPTS_1639 membrane localization and topology, researchers should employ multiple complementary techniques:
Subcellular fractionation: Separate bacterial cellular components (cytoplasm, inner membrane, periplasm, outer membrane) using differential centrifugation followed by immunoblotting to detect YPTS_1639. Published research on recombinant Yersinia proteins has shown that membrane proteins can distribute differently based on expression conditions, with some recombinant membrane proteins showing both cytoplasmic and membrane distribution .
Protease accessibility assays: Expose intact cells, spheroplasts, or membrane vesicles to proteases and analyze the digestion pattern to determine exposed regions of YPTS_1639.
Reporter fusion analysis: Create fusion proteins with reporters like alkaline phosphatase or GFP at different positions to determine membrane topology.
Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and assess their accessibility to membrane-impermeable sulfhydryl reagents.
Computational prediction: Use algorithms like TMHMM, MEMSAT, or Phobius to predict membrane-spanning regions and compare with experimental results.
A comprehensive approach using multiple methods is recommended, as single techniques may yield incomplete or potentially misleading results. When interpreting results, consider that recombinant expression of membrane proteins often results in some protein fraction being present in the cytoplasm, as observed with other recombinant Yersinia proteins .
Developing effective research questions for YPTS_1639 studies requires understanding the principles of good research question formulation. When studying this membrane protein, researchers should ensure their questions are clear, focused, relevant, complex, and testable .
The following table outlines research question types applicable to YPTS_1639 studies:
| Research Question Type | Example Formulation for YPTS_1639 Studies |
|---|---|
| Correlational research question | What is the relationship between YPTS_1639 expression levels and Yersinia pseudotuberculosis virulence? |
| Exploratory research question | Is it possible that YPTS_1639 plays a role in antibiotic resistance mechanisms? |
| Explanatory research question | What mechanisms enable YPTS_1639 to affect bacterial membrane integrity? |
| When formulating research questions about YPTS_1639, ensure they are: |
Specific and focused: Address particular aspects of YPTS_1639 function rather than general membrane protein properties.
Relevant and concise: Express main ideas in as few words as possible while maintaining precision.
Complex enough: Avoid questions that can be answered with a simple "yes" or "no" - instead, focus on mechanisms, relationships, or comparative analyses.
Testable: Ensure the question can be investigated through experimental methodologies available for membrane protein research .
Studying protein-protein interactions involving membrane proteins like YPTS_1639 requires specialized approaches. Recommended protocols include:
Bacterial two-hybrid systems: Modified specifically for membrane proteins, these systems allow in vivo detection of interactions. When using this approach, ensure controls include known non-interacting membrane proteins of similar size.
Co-immunoprecipitation: When performed with appropriate detergents to solubilize membrane proteins, co-IP can identify interaction partners. Use mild detergents like DDM or CHAPS that preserve protein-protein interactions.
Cross-linking studies: Chemical cross-linkers of various arm lengths can capture transient interactions. After cross-linking, mass spectrometry analysis can identify interaction partners.
Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics between purified YPTS_1639 and potential partners.
For all these methods, proper experimental controls are essential. These should include:
Negative controls (non-related membrane proteins or known non-interactors)
Positive controls (proteins known to interact with membrane proteins)
Technical validation using multiple approaches
Documented protocols should be systematically organized in platforms like protocols.io, which enables researchers to share reproducible experimental methods with detailed parameters . This approach ensures standardization across laboratories and enhances reproducibility of YPTS_1639 interaction studies.
When encountering poor expression or purification yields with recombinant YPTS_1639, researchers should implement a systematic troubleshooting approach:
Expression optimization:
Adjust induction parameters (IPTG concentration, temperature, duration)
Test different E. coli host strains specifically designed for membrane proteins
Evaluate different promoter systems (T7 vs. araBAD)
Consider codon optimization for E. coli expression
Add membrane protein-specific chaperones (GroEL/ES, DnaK)
Solubilization optimization:
Screen multiple detergents (DDM, LDAO, OG, CHAPS) at various concentrations
Test different solubilization temperatures and durations
Consider adding stabilizing agents (glycerol, specific lipids)
Adjust buffer composition (pH, salt concentration)
Purification troubleshooting:
Protein verification:
Confirm protein identity by Western blot using anti-His antibodies
Verify protein integrity using mass spectrometry
Assess protein homogeneity by analytical SEC
When optimizing expression, note that subcellular localization studies with other recombinant Yersinia membrane proteins have shown variable distribution patterns, with proteins sometimes found in both the cytoplasm and membrane fractions . This knowledge can guide extraction strategies to maximize yield.
Despite the availability of recombinant YPTS_1639 protein for research purposes , significant knowledge gaps remain regarding its physiological function and potential research applications. Future research should address:
Functional characterization: The UPF0299 family of membrane proteins remains poorly characterized. Systematic studies comparing YPTS_1639 with homologs from other bacterial species could provide insights into conserved functions.
Structural biology approaches: X-ray crystallography or cryo-EM studies of YPTS_1639 would enhance understanding of its membrane topology and potential functional sites.
Role in pathogenesis: Investigation of YPTS_1639 in the context of Yersinia pseudotuberculosis virulence, potentially using methods similar to those employed in studies of other Yersinia membrane components .
Applications in biotechnology: Exploring whether YPTS_1639 can serve as a scaffold for membrane protein engineering or as a target for antimicrobial development.
Standardized protocols: Development of optimized, reproducible protocols for YPTS_1639 expression, purification, and functional studies, ideally shared through platforms like protocols.io .
Researchers approaching YPTS_1639 studies should consider experimental design principles carefully , develop well-formulated research questions , and implement rigorous methodological approaches with appropriate controls. As with all membrane protein research, technical challenges are likely, but systematic troubleshooting and method optimization can lead to significant advances in understanding this understudied protein.